BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0223 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC14C4.02c |smc5|spr18|Smc5-6 complex SMC subunit Smc5 |Schizo... 29 0.45 SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 25 5.6 >SPAC14C4.02c |smc5|spr18|Smc5-6 complex SMC subunit Smc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1065 Score = 29.1 bits (62), Expect = 0.45 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 219 QVDIDSNGIRLLDKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQ 350 ++ I+ ++ ++ S++ E YD EI++L FD SV+ Sbjct: 838 KISIEETKLKFMNVNSYVMEQYDARKKEIEELESKMSDFDQSVE 881 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 25.4 bits (53), Expect = 5.6 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 330 PFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIG-NIVNIFSKLLY 464 PF ++ ID L V P+N+DM +G V+IF LY Sbjct: 838 PFFSNKLFIDQDFILGFLDLVASEPINVDMTDVGTQFVHIFHASLY 883 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,064,347 Number of Sequences: 5004 Number of extensions: 38182 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -