BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0219 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 23 2.3 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 4.1 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 22.6 bits (46), Expect = 2.3 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +3 Query: 447 YYILNKFQYTSYKLEYKKLWGGHFA 521 Y+I N +Q +Y KK W A Sbjct: 61 YFISNVYQILAYNFWKKKYWSEFLA 85 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 198 KFIRVPNSIQVRAAETLSFVASAPRNVLLL 287 +FIRV +S + + L+ AS P N+ L Sbjct: 145 EFIRVHHSGSITRSIRLTITASCPMNLQYL 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,163 Number of Sequences: 336 Number of extensions: 2358 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -