BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0219 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted ... 23 6.6 >DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted polypeptide protein. Length = 144 Score = 23.0 bits (47), Expect = 6.6 Identities = 16/73 (21%), Positives = 33/73 (45%) Frame = +3 Query: 249 SFVASAPRNVLLLTIYEAVSAKVA*AYQVWRPLVLNFHKFEFRVIMFTKLSVIYGLKLWI 428 +F+A P +V LT +++ +Y +W P + KF R ++ S K+W Sbjct: 25 TFLAHIPVDVSTLTTTLHPCNRLSNSYGLWTPWKMLPDKFIERSNSSSQPSPFVAFKVWQ 84 Query: 429 GRFCIIYYILNKF 467 + + ++ +F Sbjct: 85 TKSIVSDSVVQRF 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,690 Number of Sequences: 2352 Number of extensions: 9076 Number of successful extensions: 21 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -