BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0218 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 1.7 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 1.7 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 4.0 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 4.0 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 6.9 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 6.9 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 21 9.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.2 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 80 FLKFTMALDLVSIAQPHYIPGYTGHCPEYKY 172 ++K L + S A+ +PG CP YKY Sbjct: 294 YVKIVYYLGIPSEARELQLPGCEVLCPLYKY 324 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 80 FLKFTMALDLVSIAQPHYIPGYTGHCPEYKY 172 ++K L + S A+ +PG CP YKY Sbjct: 309 YVKIVYYLGIPSEARELQLPGCEVLCPLYKY 339 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 343 VYKHPMIPGYEGFSGHVP 396 +YKH M+P E FS + P Sbjct: 85 IYKHGMLPRGELFSLYYP 102 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 343 VYKHPMIPGYEGFSGHVP 396 +YKH M+P E FS + P Sbjct: 85 IYKHGMLPRGELFSLYYP 102 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +3 Query: 420 SSKKLTNSALCDFSSNYRRRQSTEWAPVN 506 +S ++ N+ + SNYR + + P N Sbjct: 380 ASSRMENNLRGETQSNYREMEKRQSVPAN 408 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +1 Query: 133 YSWVHGXLSRVQVSDRRYVWLD 198 + W + R++ D YVW D Sbjct: 129 HPWFKKSVQRIKPYDEYYVWRD 150 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 51 LHNYSAKNIXF*NLQWLWI*SVSPNRI 131 LHN ++ NL WL++ + P+ I Sbjct: 24 LHNNMCTSLNLSNLFWLFVGTYFPSLI 50 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 242 SLNAARSDREGSCVLSSHTYRRS 174 SLN A+S ++ C+ T +R+ Sbjct: 1638 SLNVAKSLQDHDCIRQERTQQRN 1660 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,403 Number of Sequences: 438 Number of extensions: 4337 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -