BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0218 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49110.1 68418.m06079 expressed protein ; expression support... 31 0.44 At5g61350.1 68418.m07698 protein kinase family protein contains ... 31 0.77 At3g61690.1 68416.m06913 expressed protein 29 1.8 At4g39270.1 68417.m05562 leucine-rich repeat transmembrane prote... 29 2.4 At5g67030.2 68418.m08451 zeaxanthin epoxidase (ZEP) (ABA1) ident... 29 3.1 At5g67030.1 68418.m08450 zeaxanthin epoxidase (ZEP) (ABA1) ident... 29 3.1 At1g47510.1 68414.m05273 endonuclease/exonuclease/phosphatase fa... 29 3.1 At1g31000.1 68414.m03796 F-box family protein contains F-box dom... 29 3.1 At1g68050.1 68414.m07774 F-box family protein (FKF1) / adagio 3 ... 28 5.4 At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /... 28 5.4 At4g15215.1 68417.m02332 ABC transporter family protein similar ... 27 9.5 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 27 9.5 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 27 9.5 >At5g49110.1 68418.m06079 expressed protein ; expression supported by MPSS Length = 1487 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +3 Query: 336 RSRLQASHDTRIRRVFGSCAVRFQRFGESSKKLTNSALCDFSSNYRRRQSTEWAPVNV 509 +S L+A + + +F VR +FGESS + +AL ++YR + +W PV + Sbjct: 299 KSDLRAFNHFTVAVLFSVARVR--KFGESSLGMLRTALLTAYNDYRLSKDCKWLPVEL 354 >At5g61350.1 68418.m07698 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 842 Score = 30.7 bits (66), Expect = 0.77 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +3 Query: 300 RDRHRERTFP*WRSRLQASHDTRIRRVFGSCAVRFQRFGESSKKLTNSALCDFSSN 467 +D ++ +F W L ASH + I GS + R FG SKK ++ F SN Sbjct: 453 KDWQKQNSFSSWLLPLHASHSSYISSKGGSTSRRMSIFG--SKKSKSNGFSSFFSN 506 >At3g61690.1 68416.m06913 expressed protein Length = 1303 Score = 29.5 bits (63), Expect = 1.8 Identities = 22/73 (30%), Positives = 36/73 (49%) Frame = +1 Query: 196 DNTQDPSRSERAAFREAGAIDRTADDFQIYRPAQNEIDIVNARFRNGDPVYKHPMIPGYE 375 D+T D S + + + E G++ +DF + Q E D+VN+ + G + Sbjct: 568 DSTADMSSAVNSYYDEVGSVS-VNEDFSV-AGEQEEQDLVNSM----------TSVTG-Q 614 Query: 376 GFSGHVPYGFNVS 414 GF+GH P+ FN S Sbjct: 615 GFNGHFPFPFNFS 627 >At4g39270.1 68417.m05562 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinase erecta, Arabidopsis thaliana Length = 864 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 348 VNGIAITETCVHDVYLVLCW-TVDLEVIGRSIDSTSLSECCTLGSRRILCVVEPYVS 181 V G A T TC +DVY C+ + LE+I + +S C ++IL + PY+S Sbjct: 681 VPGSAATATCAYDVY---CFGKILLELITGKL---GISSCKETQFKKILTEIMPYIS 731 >At5g67030.2 68418.m08451 zeaxanthin epoxidase (ZEP) (ABA1) identical to GI:9857296 AtABA1; controls Pfam profiles PF01360: Monooxygenase and PF00498: FHA domain; identical to cDNA AtABA1, GI:9857295 Length = 610 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 586 CVVGQHTDVLMVDLSGIYG*WRIRFDTFTGAHS 488 C+ G + L+ GI G W ++FDTFT A S Sbjct: 152 CITGDRINGLV---DGISGTWYVKFDTFTPAAS 181 >At5g67030.1 68418.m08450 zeaxanthin epoxidase (ZEP) (ABA1) identical to GI:9857296 AtABA1; controls Pfam profiles PF01360: Monooxygenase and PF00498: FHA domain; identical to cDNA AtABA1, GI:9857295 Length = 667 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 586 CVVGQHTDVLMVDLSGIYG*WRIRFDTFTGAHS 488 C+ G + L+ GI G W ++FDTFT A S Sbjct: 152 CITGDRINGLV---DGISGTWYVKFDTFTPAAS 181 >At1g47510.1 68414.m05273 endonuclease/exonuclease/phosphatase family protein similar to SP|P32019 Type II inositol-1,4,5-trisphosphate 5-phosphatase precursor (EC 3.1.3.56) {Homo sapiens}; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 334 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 131 YIPGYTGHCPEYKYRIGDTYGSTTHKI 211 Y G G P YKY +G + T+HKI Sbjct: 257 YSEGTLGFKPTYKYNVGSSDYDTSHKI 283 >At1g31000.1 68414.m03796 F-box family protein contains F-box domain Pfam:PF00646 Length = 363 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 514 FDTFTGAHSV-LCLLR*FDEKSQRAELVSFFDDSPKR*NRTAHDPKTLR 371 + FTG + CL+R FD ++++ +LVS ++S + R H P ++ Sbjct: 198 YGAFTGGDMLEWCLMR-FDVRTEKLDLVSRLNESSIQCYRPGHSPSLIK 245 >At1g68050.1 68414.m07774 F-box family protein (FKF1) / adagio 3 (ADO3) E3 ubiquitin ligase SCF complex F-box subunit; identical to FKF1 GI:6960305 and Adagio 3 GI:13487072 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif, PF00785: PAC motif and PF00646: F-box domain; contains TIGRfam profile TIGR00229: PAS domain S-boxidentical to cDNA Adagio 3 (ADO3) GI:13487071 Length = 619 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 168 SIGSAIRMARQHTRSFSIRACSIQRGW 248 SIGSA R RQ T++ S+R Q W Sbjct: 234 SIGSACRRLRQLTKNESVRKMVCQNAW 260 >At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF00271 helicase conserved C-terminal domain, PF01535 PPR repeat, PF00270: DEAD/DEAH box helicase Length = 1145 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 397 YGFNVSASRRKSSLIQLSATFRRITEEGRA 486 Y +S RK SL + FR++TEEG A Sbjct: 1047 YNIMISELCRKDSLSKADILFRKMTEEGHA 1076 >At4g15215.1 68417.m02332 ABC transporter family protein similar to PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1390 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +3 Query: 423 SKKLTNSALCDFSSNYRRRQSTEWAPVNVSNLI----LHYP*IPLRSTISTSVCCPTTQS 590 S +L++S +Y +E+ P S+ I LH P + +R T+ S CC S Sbjct: 185 SGRLSHSVKVGGKVSYNGCLLSEFIPEKTSSYISQNDLHIPELSVRETLDFSACCQGIGS 244 Query: 591 R 593 R Sbjct: 245 R 245 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 343 RDRHYGNVRSRCLSRSVLDGRSGSHRPFYR 254 RDR +G RSR +SRS R R YR Sbjct: 148 RDRSHGRSRSRSISRSRSPRRPSDSRSRYR 177 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 343 RDRHYGNVRSRCLSRSV-LDGRSGSHRPFYR 254 R R Y + R R S S GRS S+ PFYR Sbjct: 191 RSRSYSSDRGRSYSPSYGRRGRSSSYSPFYR 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,849,719 Number of Sequences: 28952 Number of extensions: 307360 Number of successful extensions: 763 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -