BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0214 (598 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT012323-1|AAS77448.1| 323|Drosophila melanogaster AT25213p pro... 65 8e-11 BT001366-1|AAN71121.1| 323|Drosophila melanogaster AT30609p pro... 65 8e-11 AE013599-1255|AAF58679.2| 323|Drosophila melanogaster CG18335-P... 65 8e-11 BT022411-1|AAY54827.1| 103|Drosophila melanogaster IP08053p pro... 35 0.096 AE013599-1258|AAF58677.1| 94|Drosophila melanogaster CG18336-P... 35 0.096 BT003783-1|AAO41464.1| 994|Drosophila melanogaster LP02833p pro... 28 8.4 AE014297-1651|AAF54925.1| 988|Drosophila melanogaster CG8773-PA... 28 8.4 >BT012323-1|AAS77448.1| 323|Drosophila melanogaster AT25213p protein. Length = 323 Score = 64.9 bits (151), Expect = 8e-11 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 101 LDLVSIAQPHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLS 256 +D +PH +PGYTGHC + + R+G TYG THK+L+DP + H+ L+++ Sbjct: 1 MDHAITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVA 52 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 376 GXSGHVPYGFQRFGESSKKLXNSALCDFSS-NYRRKAE 486 G SGH+P RFGES+K L N ALC FS Y+RK + Sbjct: 207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRD 244 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 289 PAQNEIDIVNARFRNXDPVYKHPMIPGYEG 378 P + E+ I+ R D VY+HP++PGY G Sbjct: 64 PTEQELKILRTREGLVDSVYRHPILPGYAG 93 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTH 205 +P Y GH P Y+ G TY TT+ Sbjct: 275 VPNYAGHVPGETYKFGRTYAKTTY 298 >BT001366-1|AAN71121.1| 323|Drosophila melanogaster AT30609p protein. Length = 323 Score = 64.9 bits (151), Expect = 8e-11 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 101 LDLVSIAQPHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLS 256 +D +PH +PGYTGHC + + R+G TYG THK+L+DP + H+ L+++ Sbjct: 1 MDHAITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVA 52 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 376 GXSGHVPYGFQRFGESSKKLXNSALCDFSS-NYRRKAE 486 G SGH+P RFGES+K L N ALC FS Y+RK + Sbjct: 207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRD 244 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 289 PAQNEIDIVNARFRNXDPVYKHPMIPGYEG 378 P + E+ I+ R D VY+HP++PGY G Sbjct: 64 PTEQELKILRTREGLVDSVYRHPILPGYAG 93 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTH 205 +P Y GH P Y+ G TY TT+ Sbjct: 275 VPNYAGHVPGETYKFGRTYAKTTY 298 >AE013599-1255|AAF58679.2| 323|Drosophila melanogaster CG18335-PA protein. Length = 323 Score = 64.9 bits (151), Expect = 8e-11 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 101 LDLVSIAQPHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLS 256 +D +PH +PGYTGHC + + R+G TYG THK+L+DP + H+ L+++ Sbjct: 1 MDHAITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVA 52 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 376 GXSGHVPYGFQRFGESSKKLXNSALCDFSS-NYRRKAE 486 G SGH+P RFGES+K L N ALC FS Y+RK + Sbjct: 207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRD 244 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 289 PAQNEIDIVNARFRNXDPVYKHPMIPGYEG 378 P + E+ I+ R D VY+HP++PGY G Sbjct: 64 PTEQELKILRTREGLVDSVYRHPILPGYAG 93 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTH 205 +P Y GH P Y+ G TY TT+ Sbjct: 275 VPNYAGHVPGETYKFGRTYAKTTY 298 >BT022411-1|AAY54827.1| 103|Drosophila melanogaster IP08053p protein. Length = 103 Score = 34.7 bits (76), Expect = 0.096 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTT 202 IP Y GH P K+R+G+TYG +T Sbjct: 69 IPRYGGHVPGNKFRVGNTYGRST 91 >AE013599-1258|AAF58677.1| 94|Drosophila melanogaster CG18336-PA protein. Length = 94 Score = 34.7 bits (76), Expect = 0.096 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTT 202 IP Y GH P K+R+G+TYG +T Sbjct: 60 IPRYGGHVPGNKFRVGNTYGRST 82 >BT003783-1|AAO41464.1| 994|Drosophila melanogaster LP02833p protein. Length = 994 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 318 VHDVYLVLCWTVDLEVIXRSIDSTSLSECCTLG 220 + +Y L WTV + + + T+LS C+LG Sbjct: 761 IEPIYTALTWTVGEDHLDNRLRVTALSAACSLG 793 >AE014297-1651|AAF54925.1| 988|Drosophila melanogaster CG8773-PA protein. Length = 988 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 318 VHDVYLVLCWTVDLEVIXRSIDSTSLSECCTLG 220 + +Y L WTV + + + T+LS C+LG Sbjct: 755 IEPIYTALTWTVGEDHLDNRLRVTALSAACSLG 787 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,880,621 Number of Sequences: 53049 Number of extensions: 525674 Number of successful extensions: 1233 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1233 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2420893683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -