BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0210 (432 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0498 - 34341441-34341575,34341808-34341945,34342019-343421... 27 6.5 01_06_1664 - 38984545-38984615,38984706-38984802,38985362-389855... 27 6.5 >03_06_0498 - 34341441-34341575,34341808-34341945,34342019-34342117, 34342320-34342400,34342548-34342610,34342717-34342764, 34343033-34343410,34345413-34345537,34345635-34345701, 34345797-34345856,34346495-34346621,34346670-34346986 Length = 545 Score = 27.1 bits (57), Expect = 6.5 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +1 Query: 91 ALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVL 222 A+++A+ M + P PRW + + ++ ++ D KA A+ L Sbjct: 259 AVIMAIGMWNLPPSPRWLLLRAVQGKA-SVEDNKKKAIQALRSL 301 >01_06_1664 - 38984545-38984615,38984706-38984802,38985362-38985523, 38985736-38985825,38986125-38986226,38986373-38986446, 38986587-38986615,38986766-38986989 Length = 282 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 178 CSCPFFQFS*RSSTWAREQHWSCSKP 101 CS FS + WA E+H +CS P Sbjct: 126 CSSSSTCFSGKGPFWAHEKHGTCSSP 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,824,735 Number of Sequences: 37544 Number of extensions: 184205 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -