BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0208 (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK097411-1|BAC05040.1| 656|Homo sapiens protein ( Homo sapiens ... 31 2.3 BC011375-1|AAH11375.1| 989|Homo sapiens THRAP4 protein protein. 31 4.1 AF277379-1|AAF78764.1| 989|Homo sapiens vitamin D receptor-inte... 31 4.1 AF055995-1|AAC39855.1| 989|Homo sapiens thyroid hormone recepto... 31 4.1 AF451983-1|AAP97681.1| 283|Homo sapiens hepatoma-derived growth... 29 9.5 >AK097411-1|BAC05040.1| 656|Homo sapiens protein ( Homo sapiens cDNA FLJ40092 fis, clone TESTI2003756. ). Length = 656 Score = 31.5 bits (68), Expect = 2.3 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +1 Query: 91 SMATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQIAKIAALTVVASS 234 S A ++ K PP ++S+S+P PA + + Q+ + T A+S Sbjct: 28 STAPVSGKKHRPPGPLFSSSDPLPATSYHSRDTAQVTSLIPATFTAAS 75 Score = 31.5 bits (68), Expect = 2.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 91 SMATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQIAKIAALTVVASS 234 S A ++ K PP ++S+S+P PA S Q+ + T A+S Sbjct: 299 STAPVSGKKHRPPGPLFSSSDPLPATSSHSRDSAQVTSLIPATFTAAS 346 >BC011375-1|AAH11375.1| 989|Homo sapiens THRAP4 protein protein. Length = 989 Score = 30.7 bits (66), Expect = 4.1 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = +3 Query: 210 STNSGRFLLHLGNLYLASSWVAARSSCHQLEQLDAMLDKELALEGRAYGNDALVADEPLP 389 S+ R LLH+ L ASSW A S +L ++ A L L +A L+ P Sbjct: 170 SSTKNRALLHIAKLEEASSWTAIEHSLLKLGEILANLSNP-QLRSQAEQCGTLIRSIPTM 228 Query: 390 LA-NAHALH--GVPPMLSSVLPE 449 L+ +A +H G P + + +L E Sbjct: 229 LSVHAEQMHKTGFPTVHAVILLE 251 >AF277379-1|AAF78764.1| 989|Homo sapiens vitamin D receptor-interacting protein complex component DRIP100 protein. Length = 989 Score = 30.7 bits (66), Expect = 4.1 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = +3 Query: 210 STNSGRFLLHLGNLYLASSWVAARSSCHQLEQLDAMLDKELALEGRAYGNDALVADEPLP 389 S+ R LLH+ L ASSW A S +L ++ A L L +A L+ P Sbjct: 170 SSTKNRALLHIAKLEEASSWTAIEHSLLKLGEILANLSNP-QLRSQAEQCGTLIRSIPTM 228 Query: 390 LA-NAHALH--GVPPMLSSVLPE 449 L+ +A +H G P + + +L E Sbjct: 229 LSVHAEQMHKTGFPTVHAVILLE 251 >AF055995-1|AAC39855.1| 989|Homo sapiens thyroid hormone receptor-associated protein complex component TRAP100 protein. Length = 989 Score = 30.7 bits (66), Expect = 4.1 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = +3 Query: 210 STNSGRFLLHLGNLYLASSWVAARSSCHQLEQLDAMLDKELALEGRAYGNDALVADEPLP 389 S+ R LLH+ L ASSW A S +L ++ A L L +A L+ P Sbjct: 170 SSTKNRALLHIAKLEEASSWTAIEHSLLKLGEILANLSNP-QLRSQAEQCGTLIRSIPTM 228 Query: 390 LA-NAHALH--GVPPMLSSVLPE 449 L+ +A +H G P + + +L E Sbjct: 229 LSVHAEQMHKTGFPTVHAVILLE 251 >AF451983-1|AAP97681.1| 283|Homo sapiens hepatoma-derived growth factor 4a protein. Length = 283 Score = 29.5 bits (63), Expect = 9.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 73 KEHQPDSMATITMKPEYPPSEVYSTSEPPPAY 168 +E +P+ M + +PE P +E EP PAY Sbjct: 120 QELEPEFMPELEAEPEMPETECEQEPEPQPAY 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,056,655 Number of Sequences: 237096 Number of extensions: 1732020 Number of successful extensions: 4413 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4412 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -