BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0208 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032637-13|CAA21615.1| 709|Caenorhabditis elegans Hypothetical... 29 2.5 Z73906-6|CAA98113.1| 824|Caenorhabditis elegans Hypothetical pr... 28 4.4 L23649-3|AAA27909.2| 601|Caenorhabditis elegans Tyrosinase prot... 27 7.7 >AL032637-13|CAA21615.1| 709|Caenorhabditis elegans Hypothetical protein Y43F8C.14 protein. Length = 709 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +1 Query: 61 VVMEKEHQPDSMATITMKPEY--PPSEVYSTSEPPPAYRHRVSTSV 192 +V++K P ++AT T KP PP SEPPPA++ +S+ Sbjct: 275 IVVKKLQAPIALATSTPKPAMCRPPKH----SEPPPAFQDSFVSSI 316 >Z73906-6|CAA98113.1| 824|Caenorhabditis elegans Hypothetical protein D2030.6 protein. Length = 824 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 351 YGNDALVADEPLPLANAHALH-GVPPMLSSVLPEXSQPSSXRPXLFKD 491 YG + V D+P+ ++ G PP +S ++PE P+ + KD Sbjct: 292 YGIEITVDDQPIIISEGKPKQPGEPPQVSYIVPELCFPTGLTDEMRKD 339 >L23649-3|AAA27909.2| 601|Caenorhabditis elegans Tyrosinase protein 1 protein. Length = 601 Score = 27.5 bits (58), Expect = 7.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 53 CLSKFIYCSSLGNAHCV 3 C S++++C + GN HCV Sbjct: 393 CGSQYLFCDTRGNPHCV 409 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,935,650 Number of Sequences: 27780 Number of extensions: 264982 Number of successful extensions: 766 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -