BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0206 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 85 3e-17 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 53 2e-07 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 52 4e-07 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 49 3e-06 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 44 7e-05 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 44 9e-05 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 44 1e-04 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 43 2e-04 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 43 2e-04 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 43 2e-04 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 40 0.001 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 40 0.002 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 38 0.005 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 37 0.011 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 37 0.011 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 34 0.076 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 33 0.13 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 31 0.53 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 31 0.71 SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 29 2.2 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 29 2.2 SB_14329| Best HMM Match : RRM_1 (HMM E-Value=3.5e-05) 29 2.2 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 29 2.2 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) 29 2.9 SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 29 2.9 SB_4864| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 29 2.9 SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) 29 3.8 SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_21812| Best HMM Match : GRASP55_65 (HMM E-Value=2.3) 29 3.8 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_57835| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_38316| Best HMM Match : Syja_N (HMM E-Value=0.00032) 27 8.7 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 85.4 bits (202), Expect = 3e-17 Identities = 36/61 (59%), Positives = 49/61 (80%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKPTKRK 269 D NAPKR +A+MLWLN+ R++I ++NPGI VTEV+K AGE+W++L DKS+WEEK K Sbjct: 538 DPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEK 597 Query: 270 K 272 + Sbjct: 598 Q 598 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTKRKKNT 278 KRP AFM+W E R+KI +ENP + +E++KR G W+ L DK + E+ K + Sbjct: 328 KRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRAQH 387 Query: 279 MPQ 287 M + Sbjct: 388 MKE 390 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTKRKKNT 278 KRP AFM+W E R+KI +ENP + +E++KR G W+ L DK + E+ K + Sbjct: 11 KRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRAQH 70 Query: 279 MPQ 287 M + Sbjct: 71 MKE 73 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTK 263 DVNAPK P T ++ +LNE+R+K+ ENP + EV + G +W L K + E+ K Sbjct: 173 DVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEK 232 Query: 264 RKKNTMPQ 287 K+ M + Sbjct: 233 DKERYMKE 240 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKP 257 KRP AFM+W E R+K+ ++NP + +E++KR G W+ L SE E++P Sbjct: 790 KRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLL---SEQEKRP 837 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 48.8 bits (111), Expect = 3e-06 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTKRKKNT 278 KRP +FM+W R+K EENP + E++K G+ W +L KDK + EK + + Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRIRH 154 Query: 279 MPQ 287 M + Sbjct: 155 MKE 157 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 48.0 bits (109), Expect = 6e-06 Identities = 23/56 (41%), Positives = 35/56 (62%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKP 257 D+ KRP AFM+W R+K+ EE+P + E++KR G+ W+ L SE E++P Sbjct: 41 DMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLL---SESEKRP 93 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEK 254 KRP FM+W E R +I++ENPGI ++K G W+ L ++K + EK Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEK 60 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLK--DKSEWEEKPTK 263 D NAPK P T ++ +LNE R+K+ E+P + EV K G W + DK + + + Sbjct: 140 DTNAPKAPLTGYVQFLNEQREKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAER 199 Query: 264 RKK 272 K+ Sbjct: 200 DKE 202 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKP 257 KRP AFM+W R+K+ ++ P + E++K G+LW+ L D E+KP Sbjct: 65 KRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDS---EKKP 112 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 44.0 bits (99), Expect = 9e-05 Identities = 22/46 (47%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 123 FMLWLNENRKKIIEENPGIKVTEVAKRAGELWR--DLKDKSEWEEK 254 F LWL ENR +I EENP I +V K A + W+ D +K W EK Sbjct: 336 FSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVWNEK 381 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSE 242 KRP +FM+W E R+ + ENP ++ E++K G+ WR + + + Sbjct: 11 KRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPESEK 56 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL 227 KRP +FM+W R+K+ E+ P + E++K G+LWR L Sbjct: 112 KRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRML 152 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL 227 KRP AFM+W ++ R+++ ENP + ++++K G WR L Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL 227 KRP AFM+W ++ R+++ ENP + ++++K G WR L Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKD--KSEWEEKPTK 263 D N PK P T++ + ++R K+ ++ P +K TE+A + + WR + + K + E+ + Sbjct: 148 DPNQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEERKKAYTEQYEE 207 Query: 264 RKK 272 KK Sbjct: 208 EKK 210 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = +3 Query: 111 PATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEW--EEKPTKRK 269 P +AF LW N+ RK ++ NP I ++ K+ W+++ K K W +EK RK Sbjct: 230 PLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKKEKTEMRK 286 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSE 242 KRP AFM+W +R I + P E++ R GE+W DL + + Sbjct: 102 KRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQ 147 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDK 236 D N KRP AFM+W E R+ +E P + +E++K G W+ +KD+ Sbjct: 5 DANHVKRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDE 53 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL 227 KRP A+M+W + R++I EE P + +E++KR G W L Sbjct: 9 KRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSL 49 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 40.7 bits (91), Expect = 9e-04 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTK 263 D N PKR +A+ ++N R + ++NP ++K GE+W + DK+++++ K Sbjct: 98 DPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKK 157 Query: 264 RKKNTMPQ*RSIKTAARPTSSN 329 K + ++ K P N Sbjct: 158 DKVRYESEMKAFKDGKLPAKQN 179 Score = 33.1 bits (72), Expect = 0.18 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTK 263 D N PK +A+ +L + R+K+ E + + +K + E W+++ ++K + +K K Sbjct: 8 DPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGK 67 Query: 264 RKK 272 K+ Sbjct: 68 DKE 70 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTKRKK 272 KRP AF+LW + R+ I ENP + +++++ G W+ L ++K+ + E+ K K+ Sbjct: 20 KRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKKLKE 77 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL 227 KRP AFM+W R+++ + NP + E++K G WR L Sbjct: 367 KRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRAL 407 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 123 FMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEK 254 F LWL ENR +I EENP I +V K A + W+ L + EK Sbjct: 43 FSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKLEK 86 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 38.3 bits (85), Expect = 0.005 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +3 Query: 102 PKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEE 251 P++P +M + + ++ +NP K+ ++ K G++WRDL D + +E Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDDAEKQQE 77 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 93 VNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKD 233 +N PK+P TAF+ +L R+ G +T+ +R E WRD+ D Sbjct: 472 LNFPKKPGTAFIYFLTMERES-FPRREGEGITQWTQRMAETWRDMSD 517 Score = 35.5 bits (78), Expect = 0.033 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLK 230 KRP AF + + K+ EENP +K E+ K + W +L+ Sbjct: 307 KRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANLE 348 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 37.1 bits (82), Expect = 0.011 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +3 Query: 102 PKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSE 242 P +P +A+ ++ E + I +NP + E+AK G++W +L ++ + Sbjct: 925 PPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQK 971 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKP 257 KRP AFM+W R+K+ + P + E++K G W L SE E++P Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRL---SEEEKRP 57 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 34.3 bits (75), Expect = 0.076 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEE--NPGIKVTEVAKRAGELWRDLKDKSE 242 D + PKRP TA+ L+L RK++ + G K+ + AGE WR++ D+ + Sbjct: 573 DPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSL---AGERWREMSDEDK 622 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 5/51 (9%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEEN-----PGIKVTEVAKRAGELWRDLKDKSE 242 KR ++A++ + ++ R K+ ++ P K EVAK AGE W+ L D+ + Sbjct: 497 KRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQK 547 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +3 Query: 141 ENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKPTKRKKN 275 +N KK +++ P K TE AK+A E W+ LK + W+E+ + K+ Sbjct: 230 KNIKKDLKKLP--KTTEEAKKAEERWQRLKTELNWDERYEETMKD 272 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 31.5 bits (68), Expect = 0.53 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLK--DKSEWEEK 254 KR + ++L+ +E R I +E+P E+++ GE WR+ K+E+E K Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENK 87 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 31.5 bits (68), Expect = 0.53 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLK--DKSEWEEK 254 KR + ++L+ +E R I +E+P E+++ GE WR+ K+E+E K Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENK 1320 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 31.1 bits (67), Expect = 0.71 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEKPTKRKKNT 278 K P AFM+ RK NPG+ +E +K G W+ L ++K + +P KR + T Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKMLTSEEKDPFIAEP-KRLQRT 68 >SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1963 Score = 29.9 bits (64), Expect = 1.6 Identities = 24/71 (33%), Positives = 32/71 (45%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRSQRSPSARENSGGT*KTNR 240 V SLR A + T + +T + KR P R+ + R N+GG KTN Sbjct: 900 VVESLRAAEISRTHRQVISGKPYSSQAETIHHTDKRQPNRRNNQR-KGRGNNGGQQKTNG 958 Query: 241 NGKRNQQSERR 273 N KR Q +RR Sbjct: 959 N-KRRQTQDRR 968 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVT----EVAKRAGELWRDL 227 D NAPK+PA AF ++ + R + E++ E+ K + W +L Sbjct: 51 DPNAPKKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNL 100 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +2 Query: 134 AQRKQKENH*REPRDQGHRGRQARGRTLEGPERQIGMGRETNKAKEEYNAAMKKYKDSGA 313 A++K+KE RE R++ R +Q R E R+ KAK E M+K ++ Sbjct: 296 AEKKEKERVEREQREE--RRKQEEKRRAEEQARRKAEEERAAKAKAEMEERMRKLEEKRE 353 Query: 314 AD 319 A+ Sbjct: 354 AE 355 >SB_14329| Best HMM Match : RRM_1 (HMM E-Value=3.5e-05) Length = 365 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = +2 Query: 158 H*REPRDQGHRGRQARGRTLE----GPERQIGMGRETNKAKEEYNAAMKKYKD 304 H + P GH G AR +TLE +RQ G T++ K + ++ KD Sbjct: 285 HCQNPAQGGHHGADARPQTLEELVAWSKRQTGGSTSTSEVKNSKKTSNEQVKD 337 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +2 Query: 134 AQRKQKENH*REPRDQGHRGRQARGRTLEGPERQIGMGRETNKAKEEYNAAMKKYKD 304 A++K +E H RE ++ R A+G+ E E++ E +A++E + KD Sbjct: 906 AEKKDEERHLREEEEERQRKEAAKGKK-EEEEKKEKEAEERRRAEDEERIKKQAEKD 961 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 29.1 bits (62), Expect = 2.9 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRS-QRSPSARE-NSGGT*KT 234 V SLR A + T + T+T + KR P R+ QR N+GG KT Sbjct: 2083 VVESLRAAEISRTHRQVISGKPYSSQTETIHHTDKRQPNRRNNQRKGRGNNGNNGGQQKT 2142 Query: 235 NRNGKRNQQSERR 273 N N KR Q +RR Sbjct: 2143 NGN-KRRQTQDRR 2154 >SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) Length = 385 Score = 29.1 bits (62), Expect = 2.9 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRS-QRSPSARE-NSGGT*KT 234 V SLR A + T + T+T + KR P R+ QR N+GG KT Sbjct: 169 VVESLRAAEISRTHRQVISGKPYSSQTETIHHTDKRQPNRRNNQRKGRGNNGNNGGQQKT 228 Query: 235 NRNGKRNQQSERR 273 N N KR Q +RR Sbjct: 229 NGN-KRRQTQDRR 240 >SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 469 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 163 KRTPGSRSQRSPSARENSGGT*KTNRNGKRNQQSER 270 KR P R+ + R N+GG KTN N +R Q R Sbjct: 192 KRQPNRRNNKR-KGRGNNGGQQKTNGNQRRQTQDRR 226 >SB_4864| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 426 Score = 29.1 bits (62), Expect = 2.9 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRS-QRSPSARE-NSGGT*KT 234 V SLR A + T + T+T + KR P R+ QR N+GG KT Sbjct: 169 VVESLRAAEISRTHRQVISGKPYSSQTETIHHTDKRQPNRRNNQRKGRGNNGNNGGQQKT 228 Query: 235 NRNGKRNQQSERR 273 N N KR Q +RR Sbjct: 229 NGN-KRRQTQDRR 240 >SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) Length = 517 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/70 (31%), Positives = 30/70 (42%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRSQRSPSARENSGGT*KTNR 240 V SLR A + T + +T + KR P R+ + R N+GG KTN Sbjct: 33 VVESLRAAEISRTHRQVISGKPYSSQAETIHHTDKRQPNRRNNQR-KGRGNNGGQQKTNG 91 Query: 241 NGKRNQQSER 270 N +R Q R Sbjct: 92 NKRRQTQYRR 101 >SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1165 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/70 (31%), Positives = 30/70 (42%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRSQRSPSARENSGGT*KTNR 240 V SLR A + T + +T + KR P R+ + R N+GG KTN Sbjct: 169 VVESLRAAEISRTHRQVISGKPYSSQAETIHHTDKRQPNRRNNQR-KGRGNNGGQQKTNG 227 Query: 241 NGKRNQQSER 270 N +R Q R Sbjct: 228 NKRRQTQYRR 237 >SB_21812| Best HMM Match : GRASP55_65 (HMM E-Value=2.3) Length = 660 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +1 Query: 118 PPSCCGSTKTERKSLKRTPGSRSQRSPSARENSGGT*KTNRNGKRNQQSERRIQ 279 PPS + ++ S RTP + + S+R ++GG KT + K+ + R Q Sbjct: 565 PPSRTSTPRSRAGSRTRTPPTPTSSRASSRGSAGGGAKTTKTTKKCSTRKSRGQ 618 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +2 Query: 191 GRQARGRTLEGPERQIGMGRETNKAKEEYNAAMKKYKDSGAADE 322 GR +RG +G ++ +G GR ++ + A M ++ ADE Sbjct: 1108 GRGSRGPRRKGLDKMLGRGRHRESQEQLHEAMMDTTSNAAWADE 1151 >SB_57835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 27.9 bits (59), Expect = 6.6 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +1 Query: 61 VKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRS-QRSPSARE-NSGGT*KT 234 V SLR A + T + +T + KR P R+ QR N+GG KT Sbjct: 169 VVESLRAAEISRTHRQVISGKPYSSQAETIHHTDKRQPNRRNNQRKGRGNNGNNGGQQKT 228 Query: 235 NRNGKRNQQSERRIQ 279 N N KR Q +RR Q Sbjct: 229 NGN-KRRQTQDRRHQ 242 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +3 Query: 138 NENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKPTKRKKNTMPQ*RSIKTAARP 317 NE R+ EE K E + W LKD++ + T RK +P R +RP Sbjct: 100 NEERRLAFEERKRQKEAEEKLK----WETLKDQTAKQRPGTGRKLPIVPTSRPSSAQSRP 155 Query: 318 T 320 T Sbjct: 156 T 156 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 105 KRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELW 218 +RP AFM++ +R + +++P V+K GE W Sbjct: 517 RRPMNAFMIFSKRHRALVHQKHPHQDNRTVSKILGEWW 554 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +1 Query: 61 VKRSLRNARRT*TRQ-SGRRPPSCCGSTKTERKSLKRTPGSRSQRSPSARENSGGT*KTN 237 +KR+ N RR R+ G+R + + + R S + G R+ + + + Sbjct: 460 LKRNAYNERRASARERKGKRRRTQGQAQENARASARERKGKRNAHNERKGKRNA---YNE 516 Query: 238 RNGKRNQQSERR 273 R GKRN+ +ER+ Sbjct: 517 RKGKRNEYNERK 528 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 147 RKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKPT 260 +KK+I +P I +TE A R L + +EE PT Sbjct: 776 KKKVISWSPAIYLTECAHYNKAAERHLVSRPNYEEPPT 813 >SB_38316| Best HMM Match : Syja_N (HMM E-Value=0.00032) Length = 567 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 173 RDQGHRGRQARGRTLEGPERQIGMGRETNKAKEEYNAAMKKYKDSGAADE 322 RD + ++ R+ E +R GRE KAK+E N A+K KD+ AA E Sbjct: 288 RDLAKKQQKQDHRSKESTQRD-PEGRE--KAKQENNGAVKDDKDACAACE 334 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,425,933 Number of Sequences: 59808 Number of extensions: 195892 Number of successful extensions: 781 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 776 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -