BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0206 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23800.1 68417.m03422 high mobility group (HMG1/2) family pro... 51 5e-07 At1g20693.1 68414.m02592 high mobility group protein beta1 (HMGb... 50 1e-06 At3g51880.2 68416.m05690 high mobility group protein alpha (HMGa... 50 2e-06 At3g51880.1 68416.m05689 high mobility group protein alpha (HMGa... 50 2e-06 At2g34450.1 68415.m04227 high mobility group (HMG1/2) family pro... 48 5e-06 At3g28730.1 68416.m03587 structure-specific recognition protein ... 46 1e-05 At1g20696.1 68414.m02593 high mobility group protein beta2 (HMGb... 46 1e-05 At4g11080.1 68417.m01800 high mobility group (HMG1/2) family pro... 44 1e-04 At2g17560.1 68415.m02032 high mobility group protein gamma (HMGg... 44 1e-04 At5g23420.1 68418.m02747 high mobility group (HMG1/2) family pro... 43 2e-04 At4g35570.1 68417.m05054 high mobility group protein delta (HMGd... 36 0.016 At2g37630.1 68415.m04616 myb family transcription factor (MYB91)... 31 0.77 At3g15950.1 68416.m02017 DNA topoisomerase-related similar to DN... 30 1.0 At1g23660.1 68414.m02984 expressed protein contains Pfam profile... 30 1.0 At1g52410.2 68414.m05915 caldesmon-related weak similarity to Ca... 30 1.3 At1g52410.1 68414.m05914 caldesmon-related weak similarity to Ca... 30 1.3 At5g53440.1 68418.m06641 expressed protein 28 4.1 At3g15960.1 68416.m02018 DNA mismatch repair MutS family protein... 28 4.1 At1g23580.1 68414.m02968 expressed protein contains Pfam profile... 28 4.1 At5g59320.1 68418.m07433 lipid transfer protein 3 (LTP3) identic... 28 5.4 At1g23520.1 68414.m02956 expressed protein contains Pfam profile... 28 5.4 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 27 7.2 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 27 7.2 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 27 9.5 At1g71340.1 68414.m08234 glycerophosphoryl diester phosphodieste... 27 9.5 >At4g23800.1 68417.m03422 high mobility group (HMG1/2) family protein similar to HMG2B [Homo sapiens] GI:32335; contains Pfam profile PF00505: HMG (high mobility group) box Length = 456 Score = 51.2 bits (117), Expect = 5e-07 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +3 Query: 102 PKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSEWE-EKPTKRKKNT 278 PK P +AF+++ NE R + EEN V EVAK GE W++L DK + EK K+ K T Sbjct: 255 PKHPVSAFLVYANERRAALREENK--SVVEVAKITGEEWKNLSDKKKAPYEKVAKKNKET 312 Query: 279 MPQ 287 Q Sbjct: 313 YLQ 315 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSE 242 D N PK+PA+++ L+ + RKK+ EE PG V W++L ++ + Sbjct: 375 DPNKPKKPASSYFLFSKDERKKLTEERPGTNNATVTALISLKWKELSEEEK 425 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEK 254 D KRP+++++LW + ++ +ENP E + G W+ L +DK +EE+ Sbjct: 134 DCPETKRPSSSYVLWCKDQWTEVKKENPEADFKETSNILGAKWKSLSAEDKKPYEER 190 >At1g20693.1 68414.m02592 high mobility group protein beta1 (HMGbeta1) / HMG protein beta1 nearly identical to HMG protein (HMGbeta1) [Arabidopsis thaliana] GI:2832359 Length = 144 Score = 50.0 bits (114), Expect = 1e-06 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDLKD--KSEWEEKPT 260 D N PKRPA+AF +++ + R+ +ENP K V V K AG+ W+ L D K+ + K Sbjct: 34 DPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAE 93 Query: 261 KRK 269 KRK Sbjct: 94 KRK 96 >At3g51880.2 68416.m05690 high mobility group protein alpha (HMGalpha) / HMG protein alpha nearly identical to HMG protein (HMGalpha) [Arabidopsis thaliana] GI:2832357; contains Pfam profile PF00505: HMG (high mobility group) box Length = 185 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDLK--DKSEWEEKPT 260 D N PKR +AF ++L + R +ENP +K V+ V K G+ W+ + +K+ +EEK Sbjct: 49 DPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAA 108 Query: 261 KRK 269 KRK Sbjct: 109 KRK 111 >At3g51880.1 68416.m05689 high mobility group protein alpha (HMGalpha) / HMG protein alpha nearly identical to HMG protein (HMGalpha) [Arabidopsis thaliana] GI:2832357; contains Pfam profile PF00505: HMG (high mobility group) box Length = 178 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDLK--DKSEWEEKPT 260 D N PKR +AF ++L + R +ENP +K V+ V K G+ W+ + +K+ +EEK Sbjct: 49 DPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAA 108 Query: 261 KRK 269 KRK Sbjct: 109 KRK 111 >At2g34450.1 68415.m04227 high mobility group (HMG1/2) family protein similar to HMG protein [Arabidopsis thaliana] GI:2832361; contains Pfam profile PF00505: HMG (high mobility group) box Length = 151 Score = 48.0 bits (109), Expect = 5e-06 Identities = 22/60 (36%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = +3 Query: 102 PKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDL--KDKSEWEEKPTKRKK 272 PK+PATAF +L++ RK+ EENP +K + E+ K GE W+ + ++K ++ + T++++ Sbjct: 63 PKKPATAFFFFLDDFRKQYQEENPDVKSMREIGKTCGEKWKTMTYEEKVKYYDIATEKRE 122 >At3g28730.1 68416.m03587 structure-specific recognition protein 1 / high mobility group protein / HMG protein nearly identical to SP|Q05153 Structure-specific recognition protein 1 homolog (HMG protein) {Arabidopsis thaliana}; contains Pfam profile PF00505: HMG (high mobility group) box; contains Pfam profile PF03531: Structure-specific recognition protein Length = 646 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLK--DKSEWEEK 254 D NAPKR + FM + R I +E+PGI EV K G+ WR + DK +E K Sbjct: 558 DPNAPKRAMSGFMFFSQMERDNIKKEHPGIAFGEVGKVLGDKWRQMSADDKEPYEAK 614 >At1g20696.1 68414.m02593 high mobility group protein beta2 (HMGbeta2) / HMG protein beta2 nearly identical to HMG protein (HMGbeta2) [Arabidopsis thaliana] GI:2832361 Length = 141 Score = 46.4 bits (105), Expect = 1e-05 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDLKD--KSEWEEKPT 260 D N PKRP++AF +++ + R EE+P K V V K GE W+ L D K+ + K Sbjct: 31 DPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKAD 90 Query: 261 KRK 269 KRK Sbjct: 91 KRK 93 >At4g11080.1 68417.m01800 high mobility group (HMG1/2) family protein similar to SP|P40618 High mobility group protein HMG2A {Gallus gallus}; contains Pfam profile PF00505: HMG (high mobility group) box Length = 446 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +3 Query: 102 PKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKD--KSEWEEKPTKRKK 272 PK+P +A++++ NE R + EN V EVAK AGE W++L + K+ +++ K K+ Sbjct: 246 PKQPISAYLIYANERRAALKGENKS--VIEVAKMAGEEWKNLSEEKKAPYDQMAKKNKE 302 Score = 41.9 bits (94), Expect = 3e-04 Identities = 16/51 (31%), Positives = 30/51 (58%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSE 242 D N PK+P +++ L+ + RK ++EE+PGI + V W +L ++ + Sbjct: 368 DPNKPKKPTSSYFLFCKDARKSVLEEHPGINNSTVTAHISLKWMELGEEEK 418 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDL--KDKSEWEEK 254 D KRP+T ++LW +N ++ ++NP E + G W+ + ++K +EEK Sbjct: 125 DCAETKRPSTPYILWCKDNWNEVKKQNPEADFKETSNILGAKWKGISAEEKKPYEEK 181 >At2g17560.1 68415.m02032 high mobility group protein gamma (HMGgamma) / HMG protein gamma nearly identical to HMG protein (HMGgamma) [Arabidopsis thaliana] GI:2832355 Length = 138 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDL--KDKSEWEEKPT 260 D N PKRP +AF ++L + RK+ NP K V V K AG W+ + +DK+ + K Sbjct: 31 DPNQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDEDKAPYVAKAE 90 Query: 261 KRK 269 RK Sbjct: 91 SRK 93 >At5g23420.1 68418.m02747 high mobility group (HMG1/2) family protein similar to high mobility group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box Length = 241 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +3 Query: 96 NAPKRPATAFMLWLNENRKKIIEENPGIKVTEVAKRAGELWRDLKDKSE 242 N PKRP TAF +++++ RK E+ G + AK GE W+ L ++ + Sbjct: 113 NKPKRPLTAFFIFMSDFRKTFKSEHNGSLAKDAAKIGGEKWKSLTEEEK 161 >At4g35570.1 68417.m05054 high mobility group protein delta (HMGdelta) / HMG protein delta identical to HMG protein (HMGdelta) [Arabidopsis thaliana] GI:2832363 Length = 125 Score = 36.3 bits (80), Expect = 0.016 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 90 DVNAPKRPATAFMLWLNENRKKIIEENPGIK-VTEVAKRAGELWRDLKDK 236 D N PK+P + F ++L++ RK+ NP K V V + AG+ W+ + ++ Sbjct: 30 DPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEE 79 >At2g37630.1 68415.m04616 myb family transcription factor (MYB91) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 367 Score = 30.7 bits (66), Expect = 0.77 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 150 KKIIEENPGIKVTEVAKRAGELWRDLKDKSEWEEKPTKRK 269 KKI E PG AKR G+ W K+K + EEK + ++ Sbjct: 82 KKIAAEVPG----RTAKRLGKWWEVFKEKQQREEKESNKR 117 >At3g15950.1 68416.m02017 DNA topoisomerase-related similar to DNA topoisomerase IV subunit A (GI:26454107) [Mycoplasma penetrans] Length = 772 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 248 RETNKAKEEYNAAMKKYKDSGAADEF 325 +E ++A EEY+ A+ K KD AA+EF Sbjct: 727 KEASQAYEEYHEAVHKAKDEQAAEEF 752 >At1g23660.1 68414.m02984 expressed protein contains Pfam profile PF02713: Domain of unknown function DUF220; expression supported by MPSS Length = 264 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 198 KRAGELWRDLKDKSEWEEKPTKRKKNT 278 +R GE+WR ++K W + P K K T Sbjct: 45 RREGEIWRAAEEKHPWYDAPAKVKVTT 71 >At1g52410.2 68414.m05915 caldesmon-related weak similarity to Caldesmon (CDM) (Swiss-Prot:P12957) [Gallus gallus] Length = 759 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 251 ETNKAKEEYNAAMKKYKDSGAADEF 325 + ++A EEY+ A++K KD AA+EF Sbjct: 716 DASEAYEEYHGAVRKAKDEQAAEEF 740 >At1g52410.1 68414.m05914 caldesmon-related weak similarity to Caldesmon (CDM) (Swiss-Prot:P12957) [Gallus gallus] Length = 755 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 251 ETNKAKEEYNAAMKKYKDSGAADEF 325 + ++A EEY+ A++K KD AA+EF Sbjct: 712 DASEAYEEYHGAVRKAKDEQAAEEF 736 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +2 Query: 170 PRDQGHRGRQARGRTLEGPERQIGMGRETNKAKEEYNAAMKKYKDSGAADE 322 PR H+ + + T E + + + K+KEE + ++ K+SG+ D+ Sbjct: 2 PRSTRHKSSKHKDATKEYSDSEKETSLKEKKSKEESSTTVRVSKESGSGDK 52 >At3g15960.1 68416.m02018 DNA mismatch repair MutS family protein contains Pfam profile PF05188: MutS domain II Length = 474 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +2 Query: 251 ETNKAKEEYNAAMKKYKDSGAADEF 325 E ++A EEY+ ++K+K+ A++EF Sbjct: 431 EASQAYEEYHVVVRKWKEEQASEEF 455 >At1g23580.1 68414.m02968 expressed protein contains Pfam profile PF02713: Domain of unknown function DUF220 Length = 285 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +3 Query: 120 AFMLWLNENRKKIIEENPGIKVTEVAKRAGEL------WRDLKDKSEWEEK 254 AF W+N+N ++ +EE+P +K A E+ + D+ EWE + Sbjct: 6 AFGAWINQNSQQPLEEDPKSSEHVESKSASEMDNGPAKMKKYYDEDEWERQ 56 >At5g59320.1 68418.m07433 lipid transfer protein 3 (LTP3) identical to lipid transfer protein 3 from Arabidopsis thaliana [gi:8571921]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 115 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 103 QSGRRPPSCCGSTKTERKSLKRTP 174 + G PPSCC KT K TP Sbjct: 43 KGGLVPPSCCAGVKTLNSMAKTTP 66 >At1g23520.1 68414.m02956 expressed protein contains Pfam profile PF02713: Domain of unknown function DUF220; expression supported by MPSS Length = 263 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 210 ELWRDLKDKSEWEEKPTKRKKNT 278 +LWR + K +WE+ P K K T Sbjct: 48 KLWRHAEKKEQWEDVPAKVKVET 70 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +3 Query: 162 EENPGIKVTEVAKRAGELWRDLKDKSEWEEKPTKRKKNTMPQ*RSIKTAARPTSSN 329 EEN + T R+ E D+KDKS +E+ KK + + R ++ R TS N Sbjct: 647 EENKVKRRTRSRSRSVEDSADIKDKSR-DEELKHHKKRSRSRSREDRSKTRDTSRN 701 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 58 SVKRSLRNARRT*TRQSGRRPPSCCGSTKTERKSLKRTPGSRSQRSPSAR 207 S +RS A R+ R PP S+++ R + R P S ++R+ +R Sbjct: 486 SDQRSRHGAGRSGRSSFARLPPRSLASSRSARGAGSRAPSSSAKRASGSR 535 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 103 QSGRRPPSCCGSTKTERKSLKRTPGSRSQRSPSARENS 216 +S R S S + KSL+R+P + RSP +R S Sbjct: 220 RSRSRSRSRSKSRSPKAKSLRRSPAKSTSRSPRSRSRS 257 >At1g71340.1 68414.m08234 glycerophosphoryl diester phosphodiesterase family protein contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 328 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 590 RCRFQTPMMPRLGRRTLRFFLIFLGVF 510 R RF +P+ R +RT+ F +IFL +F Sbjct: 20 RRRFFSPLYSRNFKRTILFAVIFLAIF 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,856,451 Number of Sequences: 28952 Number of extensions: 143385 Number of successful extensions: 650 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -