BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0205 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 1.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 3.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.4 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 6.0 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 6.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.0 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 6.0 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.4 bits (48), Expect = 1.5 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 Query: 431 CHHRYSSKGWCEIDFY 384 CH +SS WC Y Sbjct: 138 CHQGFSSSTWCNYSAY 153 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 395 IDFYFLTLWSFWMIFDLV 342 I F F+ WS +++FDL+ Sbjct: 291 IVFVFVLCWSPYIVFDLL 308 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 21 GLPRSGNPTYEYGSRW 68 G+ SG+P YG +W Sbjct: 471 GMDESGSPYMVYGDQW 486 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 145 KAQELFACTSPCL 107 KA LFACT+ C+ Sbjct: 314 KALFLFACTNSCM 326 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 145 KAQELFACTSPCL 107 KA LFACT+ C+ Sbjct: 314 KALFLFACTNSCM 326 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 219 DTFISELSSNFIYPIEXTHNK 157 +TF +EL +++PIE K Sbjct: 1193 ETFWNELIEQYLHPIEDDKKK 1213 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 219 DTFISELSSNFIYPIEXTHNK 157 +TF +EL +++PIE K Sbjct: 1193 ETFWNELIEQYLHPIEDDKKK 1213 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 6.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 284 VIIIRICHVKSQVVNSGLCVKSIPSFRNCLPISYTL 177 VII IC + V LC ++ F+N + Y L Sbjct: 130 VIIYSICVQTEKSVFDFLCRHTVEYFQNYIHFFYQL 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,853 Number of Sequences: 336 Number of extensions: 3604 Number of successful extensions: 17 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -