BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0205 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) 159 1e-39 SB_54522| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 4e-30 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40082| Best HMM Match : tRNA-synt_2 (HMM E-Value=8.1e-37) 33 0.13 SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) 31 0.71 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 29 2.9 SB_31376| Best HMM Match : CLN3 (HMM E-Value=5.5e-06) 29 3.8 SB_39385| Best HMM Match : 7tm_1 (HMM E-Value=2.9e-28) 28 5.0 SB_38727| Best HMM Match : 7tm_1 (HMM E-Value=9.2e-30) 28 5.0 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.7 >SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1449 Score = 159 bits (387), Expect = 1e-39 Identities = 68/76 (89%), Positives = 75/76 (98%) Frame = +1 Query: 31 EVETPLMNMVPGGATAKPFITHHNELNMDLYMRIAPELYHKMLVVGGLDRVYEIGRQFRN 210 +VETPLMNM+PGGATAKPFITHHN+LNMDL+MR+APELYHKMLVVGG+DRVYEIGRQFRN Sbjct: 758 KVETPLMNMIPGGATAKPFITHHNDLNMDLFMRVAPELYHKMLVVGGIDRVYEIGRQFRN 817 Query: 211 EGIDLTHNPEFTTCDF 258 E IDLTHNPEFTTC+F Sbjct: 818 ESIDLTHNPEFTTCEF 833 Score = 111 bits (266), Expect = 5e-25 Identities = 52/88 (59%), Positives = 65/88 (73%), Gaps = 4/88 (4%) Frame = +3 Query: 255 FYMAYADYNDLMTITESILSGMVQSIHGSYKVKYHPEGPE----GKEIEIDFTPPFARVP 422 FYMAYADYNDLM ITE+++SGMV++I G YKV YHPE + GK +DFTPPF R+ Sbjct: 833 FYMAYADYNDLMEITETMISGMVKNITGGYKVTYHPEAVDADNLGKSWTVDFTPPFKRLR 892 Query: 423 MMATLERVLNVKLPAPDKLDTPEANDFL 506 M+ LE+VL V+LP+P +TPEAN L Sbjct: 893 MIPELEKVLGVRLPSPQDFNTPEANKLL 920 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +2 Query: 512 LCNTHQIECSPXRTTARXLDKLVSVXLE 595 LC H+++C+P RTTAR LDKLV LE Sbjct: 923 LCVKHEVDCAPPRTTARLLDKLVGEFLE 950 >SB_54522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 128 bits (308), Expect = 4e-30 Identities = 55/60 (91%), Positives = 60/60 (100%) Frame = +1 Query: 34 VETPLMNMVPGGATAKPFITHHNELNMDLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNE 213 VETPLMNM+PGGATAKPFITHHN+LNMDL+MR+APELYHKMLVVGG+DRVYEIGRQFRNE Sbjct: 1 VETPLMNMIPGGATAKPFITHHNDLNMDLFMRVAPELYHKMLVVGGIDRVYEIGRQFRNE 60 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.008 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 258 YMAYADYNDLMTITESILSGMVQSIHGS-YKVKYHPEG 368 YMAYADY+DL+ +TES+ + Q + G+ Y+ + G Sbjct: 100 YMAYADYHDLIELTESLFRTLAQEVLGTGYRARIRNHG 137 >SB_40082| Best HMM Match : tRNA-synt_2 (HMM E-Value=8.1e-37) Length = 479 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 121 YMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDL-THNPEFTTCD 255 ++ +P+LY +M + G D+VY IG FR E + H EF D Sbjct: 252 FLAQSPQLYKQMALTGDFDKVYTIGSVFRAEDSNTHRHLTEFIGLD 297 >SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) Length = 448 Score = 31.1 bits (67), Expect = 0.71 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +3 Query: 339 SYKVKYHPEGPEGKEIEIDFTPPFARVPMMATLERVLNVKLPAPDKLDTPEAND 500 S +V +HP P+ +E+ F PP + + + ++ +++ DK D + ND Sbjct: 365 SVEVTFHPSNPKCDSVEVHFHPPNPKCDSVEVMTKM--IRVIDDDKNDDDDYND 416 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 273 DYNDLMTITESILSGMVQSIHGSYKVKYHPEGPEGKEIEIDF 398 DY D++ +T S ++ + +KYHP+ + E+ F Sbjct: 4 DYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEVKF 45 >SB_31376| Best HMM Match : CLN3 (HMM E-Value=5.5e-06) Length = 416 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +1 Query: 19 MGFLEVETPLMNMVPG--GATAKPFITHH 99 MG +EV TP N+V G GA +P + H Sbjct: 357 MGLVEVSTPAANLVAGIVGAVIEPLLKEH 385 >SB_39385| Best HMM Match : 7tm_1 (HMM E-Value=2.9e-28) Length = 360 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 212 SFRNCLPISYTLSXPPTTSI 153 SF +CLP+SY LS P S+ Sbjct: 6 SFNSCLPLSYKLSDEPKPSL 25 >SB_38727| Best HMM Match : 7tm_1 (HMM E-Value=9.2e-30) Length = 420 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 419 YSSKGWCEIDFYFLTLWSFWMIFDLVGSMNALYH 318 Y S+GW F L + W++FD++G + ++ H Sbjct: 75 YHSEGW------FKLLHNVWLVFDILGGVGSILH 102 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +3 Query: 273 DYNDLMTITESILSGMVQSIHGSYKVKYHPEGPEGKEIEIDF 398 DY ++ + + ++ VKYHP+ +GK+ E F Sbjct: 26 DYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKDAEEKF 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,753,344 Number of Sequences: 59808 Number of extensions: 424354 Number of successful extensions: 772 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -