BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0205 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF426224-1|ABO26467.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426223-1|ABO26466.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426222-1|ABO26465.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426221-1|ABO26464.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426220-1|ABO26463.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426219-1|ABO26462.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426218-1|ABO26461.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426217-1|ABO26460.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426216-1|ABO26459.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426215-1|ABO26458.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426214-1|ABO26457.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426213-1|ABO26456.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426212-1|ABO26455.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426211-1|ABO26454.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426210-1|ABO26453.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426209-1|ABO26452.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426208-1|ABO26451.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426207-1|ABO26450.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426206-1|ABO26449.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426205-1|ABO26448.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426204-1|ABO26447.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426203-1|ABO26446.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426202-1|ABO26445.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426201-1|ABO26444.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426200-1|ABO26443.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426199-1|ABO26442.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426198-1|ABO26441.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426197-1|ABO26440.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426196-1|ABO26439.1| 94|Anopheles gambiae unknown protein. 24 3.2 EF426195-1|ABO26438.1| 94|Anopheles gambiae unknown protein. 24 3.2 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 7.5 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 7.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.9 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 9.9 >EF426224-1|ABO26467.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426223-1|ABO26466.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426222-1|ABO26465.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426221-1|ABO26464.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426220-1|ABO26463.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426219-1|ABO26462.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426218-1|ABO26461.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426217-1|ABO26460.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426216-1|ABO26459.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426215-1|ABO26458.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426214-1|ABO26457.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426213-1|ABO26456.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426212-1|ABO26455.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426211-1|ABO26454.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426210-1|ABO26453.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426209-1|ABO26452.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426208-1|ABO26451.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426207-1|ABO26450.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426206-1|ABO26449.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426205-1|ABO26448.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426204-1|ABO26447.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426203-1|ABO26446.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426202-1|ABO26445.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426201-1|ABO26444.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426200-1|ABO26443.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426199-1|ABO26442.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426198-1|ABO26441.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426197-1|ABO26440.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426196-1|ABO26439.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >EF426195-1|ABO26438.1| 94|Anopheles gambiae unknown protein. Length = 94 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 151 CDKAQELFACTSPC 110 CD+ E+F C PC Sbjct: 43 CDRKTEIFNCCGPC 56 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 408 FARVPMMATLERVLNVKLPAPD 473 F RVP + E L ++PAPD Sbjct: 185 FGRVPALLASELKLCQQMPAPD 206 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +3 Query: 36 GNPT--YEYGSRWRHCQTIHY 92 G+PT Y RW CQ +H+ Sbjct: 19 GSPTGVYSVRRRWSLCQKLHF 39 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 9.9 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -3 Query: 227 VKSIPSFRNCLPISY 183 ++S +RNCLP++Y Sbjct: 3153 LQSHDEYRNCLPLTY 3167 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.6 bits (46), Expect = 9.9 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +1 Query: 112 MDLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCDFTWHMRII 279 MDL + E+YH L + G + + + R I L + +F+ + + R+I Sbjct: 42 MDLDVIFLQEVYHTDLALPGYNVLSNVDASRRGTAIALRDHLKFSHVERSLDSRLI 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,368 Number of Sequences: 2352 Number of extensions: 14574 Number of successful extensions: 47 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -