BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0203 (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11800.1 68417.m01879 calcineurin-like phosphoesterase family... 29 1.3 At5g13270.1 68418.m01524 pentatricopeptide (PPR) repeat-containi... 28 3.0 At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, p... 28 4.0 At4g27370.1 68417.m03929 myosin family protein contains Pfam pro... 27 5.3 At1g20200.1 68414.m02524 26S proteasome regulatory subunit S3, p... 27 5.3 At5g66900.1 68418.m08433 disease resistance protein (CC-NBS-LRR ... 27 9.3 At5g23030.1 68418.m02692 senescence-associated family protein si... 27 9.3 At2g39580.1 68415.m04855 expressed protein 27 9.3 >At4g11800.1 68417.m01879 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1012 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +3 Query: 174 HILELPDSKILTLQFDKN----SLTIEWDDKTLQNFKADFLSQFDYK 302 HILE D ++ TL DK L +WD + Q+FK + +F K Sbjct: 934 HILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSK 980 >At5g13270.1 68418.m01524 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 752 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 48 LLRXRVRVNFENGPSIPXEDCWLRDHCRC 134 LL R+R+ EN PS+ ++C L+ +C C Sbjct: 104 LLHDRMRMGIEN-PSVLLQNCVLQMYCEC 131 >At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, putative (RPN3) similar to 26S proteasome regulatory subunit S3 SP:P93768 [Nicotiana tabacum (Common tobacco)] Length = 487 Score = 27.9 bits (59), Expect = 4.0 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Frame = +1 Query: 100 LKTVGSETIADVHNAITRIRSRELNTF*NCPIRRYLHYNSIRTV*QLNGTIRHYRI-SKR 276 L + S +A H+A R T N +R YLHYN +L + S + Sbjct: 177 LAEIRSTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQ 236 Query: 277 TFCRNSIIKLGK 312 FCR + LGK Sbjct: 237 QFCR-YLFYLGK 247 >At4g27370.1 68417.m03929 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif Length = 1126 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 186 LPDSKILTLQFDKNSLTIEWDDKTLQNFKADFLSQFDYKTWXNNRRLKPR 335 L D L+ +FD+ S+ I D K+L K+D +S RRLK R Sbjct: 1041 LSDVNNLSTEFDQRSVIIHEDPKSLVEVKSDSISNRKQHA-EELRRLKSR 1089 >At1g20200.1 68414.m02524 26S proteasome regulatory subunit S3, putative (RPN3) similar to SP:Q06364 from [Daucus carota] Length = 488 Score = 27.5 bits (58), Expect = 5.3 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +1 Query: 121 TIADVHNAITRIRSRELN--TF*NCPIRRYLHYNSIRTV*QLNGTIRHYRI-SKRTFCRN 291 T+ +H++ T +R EL T N +R YLHYN +L + S + FCR Sbjct: 184 TLLALHHSAT-LRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCR- 241 Query: 292 SIIKLGK 312 + LGK Sbjct: 242 YLFYLGK 248 >At5g66900.1 68418.m08433 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 809 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 258 LQNFKADFLSQFDYKTWXNNRRLKP 332 L N+K S+FD+ ++ +N RLKP Sbjct: 294 LPNYKILVTSRFDFPSFDSNYRLKP 318 >At5g23030.1 68418.m02692 senescence-associated family protein similar to senescence-associated protein 5 [Hemerocallis hybrid cultivar] gi|3551954|gb|AAC34855 Length = 264 Score = 26.6 bits (56), Expect = 9.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 294 DYKTWXNNRRLKPRLWRGL*RC 359 DY+ W N L+ + W G+ +C Sbjct: 117 DYQNWIGNHFLRGKNWEGITKC 138 >At2g39580.1 68415.m04855 expressed protein Length = 1567 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 183 ELPDSKILTLQFDKNSLTIEWDDKTLQ-NFKADFLSQFD 296 +LPDS I L+ +K L IEW L + K L FD Sbjct: 1102 KLPDSIIRRLEMEKELLEIEWPTVNLDGDLKQMALRLFD 1140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,360,758 Number of Sequences: 28952 Number of extensions: 161543 Number of successful extensions: 416 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -