BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0202 (499 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal pro... 52 2e-07 Z81573-1|CAB04625.3| 909|Caenorhabditis elegans Hypothetical pr... 27 5.7 AL132949-31|CAB61110.3| 297|Caenorhabditis elegans Hypothetical... 27 10.0 >AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal protein, large subunitprotein 4 protein. Length = 345 Score = 52.0 bits (119), Expect = 2e-07 Identities = 26/55 (47%), Positives = 35/55 (63%) Frame = +1 Query: 82 ARPLVSVYSEKSETVQGAAKPLPFVFKXPIRPDLVNDVHVSMSKNSRQPYCVRRR 246 ARPLV+VY EK E Q + LP VF+ PIRPDLV+ + + +N RQ + V + Sbjct: 3 ARPLVTVYDEKYEATQSQIR-LPAVFRTPIRPDLVSFIADQVRRNRRQAHAVNTK 56 Score = 34.3 bits (75), Expect = 0.050 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 254 QTSAESWXXXXXXXXXXXXXXXXXXXXXXXXXXNMCRGGRMFAPTKPWXXXXXXXXXXXX 433 Q SAESW NMCRGG MFAP K + Sbjct: 60 QHSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGHMFAPLKVFRRWHRNVNIAQK 119 Query: 434 XAAXXAXVAATGV 472 A + +AA+G+ Sbjct: 120 RYAVSSAIAASGI 132 >Z81573-1|CAB04625.3| 909|Caenorhabditis elegans Hypothetical protein M02G9.1 protein. Length = 909 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 130 PAPSHSSLNTPTLKVGLPIDSFRYFSEAIPPKYT 29 P S +S N PT+K+ L I+ YF PK T Sbjct: 184 PTTSSTSTNAPTIKITLNIND-AYFDSNCAPKCT 216 >AL132949-31|CAB61110.3| 297|Caenorhabditis elegans Hypothetical protein Y53F4B.36 protein. Length = 297 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/57 (21%), Positives = 24/57 (42%) Frame = +1 Query: 67 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKXPIRPDLVNDVHVSMSKNSRQPYCV 237 MS++V P +S V + + F++ P ++ D H+ + + CV Sbjct: 182 MSMAVTSPYLSKLDRLPIVVSACKRAMCFIYDRPTNSIILLDTHMHFKRRAVSVLCV 238 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,012,963 Number of Sequences: 27780 Number of extensions: 130348 Number of successful extensions: 272 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -