BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0200 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 123 1e-28 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 37 0.011 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 37 0.014 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 34 0.10 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 32 0.40 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 30 1.2 SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 30 1.6 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_42653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) 28 6.6 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 28 6.6 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 27 8.7 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 27 8.7 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 27 8.7 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 123 bits (296), Expect = 1e-28 Identities = 57/91 (62%), Positives = 59/91 (64%) Frame = +2 Query: 254 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXX 433 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 58 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQR 117 Query: 434 XXXXXXXXXXXXXXXXXQARGHIIERFPSFP 526 ARGH IE+ P Sbjct: 118 RFAVCSALAASALPALIMARGHRIEKIAEVP 148 Score = 62.9 bits (146), Expect = 2e-10 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +1 Query: 82 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVRR 243 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V + Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNK 53 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +2 Query: 242 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 403 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 14 GGWGQGPGGGWGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +2 Query: 242 GGWSQTSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 397 GG + WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 36.7 bits (81), Expect = 0.014 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +2 Query: 242 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 403 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 258 GGWGQGPGGGWGRGQGRG-MGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 Score = 30.7 bits (66), Expect = 0.93 Identities = 21/62 (33%), Positives = 26/62 (41%) Frame = +2 Query: 218 RGSPTA*EGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 397 RG GGW + S WG R++GGG R G +G M +GG P W Sbjct: 274 RGMGRGPGGGWGRGSGGGWG---------RMQGGGMGRGPGGGWGRM-QGGMGRGPGGGW 323 Query: 398 RR 403 R Sbjct: 324 GR 325 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 368 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWF 255 HH CY H Y Y+ H H + + H YP RH++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 31.9 bits (69), Expect = 0.40 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 209 PRTRGSPTA*EGGWSQTSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 373 P R SP+ T +E +G ++ R PR RGGG G G G RGGR Sbjct: 967 PSHRSSPSTPGSPSIPTPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = -3 Query: 368 HHDTCYRRHPDRTYGYHHHGHAEFGQQH-------VRYPMIRHWFVTSLL 240 HH RH R + +HHH H E+ ++H + +IRH F+ ++ Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRHRYFTDINITIQIIRHHFIIIII 373 >SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 327 WVPPPRTRGIRATARPVPHD 268 W+PP RTR R T PV H+ Sbjct: 228 WMPPVRTRPARPTVMPVTHE 247 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 368 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFVTSLLL 237 HH + RH R + YHHH + H +P FVT++++ Sbjct: 570 HHHLHHHRHHHRHHHYHHHHY----PHHHHHPCTIIIFVTTIII 609 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 377 TYVHHDTCYRRHPDRTYGYHHHGHA 303 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -3 Query: 353 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 261 Y +HP T+ YHH H + ++ ++P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 353 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 261 Y +HP T+ YH H + H ++P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 >SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 279 VPHDSALVCDQPPSHAVGLPRVLGHR 202 + HD ++ PPS A G+P VL HR Sbjct: 141 IAHDPEILSMIPPSEATGIPFVLLHR 166 >SB_42653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 444 WQQPLLLLASQRSFRLEDTLLKDSRASLGCS 536 W + +L + S R+FRL +DS+ +L C+ Sbjct: 17 WLKVILPVMSPRAFRLTPLFFQDSKGTLACA 47 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 149 GRGLAAPCTVSLFSEYTDTKGRATDRLI 66 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) Length = 278 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -3 Query: 359 TCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFVTSLL 240 TC+ HP + Y H+ H F Q H + RH+ TS L Sbjct: 52 TCFPYHPHYHHHYRHNDH-YFHQDH----LYRHYLSTSAL 86 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 366 PRHMLPKAP*PDLWVPPPRTRGIR-ATARPVPHDSALVCDQPP-SHAVGLPRV 214 P + P P P PPPR R P P S QPP S VG P V Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVV 298 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 Query: 372 RPPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHD 268 RPP H + P PD WVP P R +P D Sbjct: 250 RPPPHHDMRGP-PDQWVPGPEQRRDNMRGPGMPPD 283 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 368 HHDTCYRRHPDRTYGYHHH 312 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 374 YVHHDTCYRRHPDRTYGYHHHGH 306 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,115,989 Number of Sequences: 59808 Number of extensions: 386221 Number of successful extensions: 1280 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1047 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -