BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0199 (349 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 2.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 20 8.3 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 2.1 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = +1 Query: 19 LLYLRIARREQKLKEHG------ASSCISGKRGRRCGNIW 120 L+ L AR + L + G A+ C+ GK+ R G+ W Sbjct: 10 LVTLATARNKAPLLDDGTRTRNKAAECVFGKQVRELGSQW 49 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 19.8 bits (39), Expect = 8.3 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +1 Query: 64 HGASSCISGKRGRRCGNIWHWGSVD 138 H C G G+ CG W S + Sbjct: 82 HYTCHCPYGYTGKDCGEYVDWCSTN 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,033 Number of Sequences: 336 Number of extensions: 1345 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -