BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0197 (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 28 5.6 12_01_0718 + 6339982-6342981 27 9.9 >06_03_1450 + 30246702-30247346,30248603-30248689,30248789-30248920, 30249016-30249162,30250375-30250440,30250519-30250629, 30251551-30251584,30251667-30251743,30251829-30251906 Length = 458 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 359 LRVYYLNRIVKWKIIEG*IFYFVSILIIHFTQETI-LSK*SYT 234 LR+Y L + +W +++ IF F S + F I L SYT Sbjct: 232 LRIYPLETVTRWDVLDSSIFAFWSKSSVDFEARRIRLKSNSYT 274 >12_01_0718 + 6339982-6342981 Length = 999 Score = 27.1 bits (57), Expect = 9.9 Identities = 21/80 (26%), Positives = 37/80 (46%) Frame = +3 Query: 279 DEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSNYYI 458 D ++ + LN+ + I K KN L +PPL D ++ ++++ +NY Sbjct: 593 DYSNNQFSSMPLNFSTYLKKTIIF--KASKNNLSG-NIPPLICDGIKSLQLIDLSNNYLT 649 Query: 459 SRXRSCYTENAFQNVQVICL 518 SC E+A +QV+ L Sbjct: 650 GIIPSCLMEDA-SALQVLSL 668 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,362,866 Number of Sequences: 37544 Number of extensions: 174189 Number of successful extensions: 300 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -