BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0197 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61060.1 68418.m07662 histone deacetylase family protein simi... 29 2.7 At3g10320.1 68416.m01238 expressed protein contains Pfam domain,... 28 4.7 At3g55150.1 68416.m06125 exocyst subunit EXO70 family protein co... 27 6.2 >At5g61060.1 68418.m07662 histone deacetylase family protein similar to SP|Q9UBN7 Histone deacetylase 6 (HD6) {Homo sapiens}; contains Pfam profile PF00850: Histone deacetylase family Length = 660 Score = 28.7 bits (61), Expect = 2.7 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +1 Query: 31 HIYIIHNREFVSLMRRLCANKTDYKNKRI 117 H+ ++H ++ V+L++ + + DY+ RI Sbjct: 81 HLQLVHTKDHVNLVKSISTKQKDYRRNRI 109 >At3g10320.1 68416.m01238 expressed protein contains Pfam domain, PF04577: Protein of unknown function (DUF563) Length = 494 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 210 KQVDIDSNGIRLL**YSFLCEMYDEDADEIKD---LTLNYFPFDNSVQIIDAK 359 K++ +D NG ++L S L E YD+D +KD +T + F + + D K Sbjct: 421 KKLGLDYNGYKILPRESSLYEKYDKDDPILKDPNSITKKGWQFTKGIYLNDQK 473 >At3g55150.1 68416.m06125 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; tomato leucine zipper-containing protein, Lycopersicon esculentum, PIR:S21495 Length = 636 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 264 LCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRV 386 LC++ D A+ KD++L+Y N++QII G L+ + Sbjct: 445 LCKL-DTKAEHYKDVSLSYLFLANNLQIIIETVGSTPLRNL 484 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,821,525 Number of Sequences: 28952 Number of extensions: 162830 Number of successful extensions: 353 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -