Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0196
         (449 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           22   3.6  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    21   8.2  

>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 21.8 bits (44), Expect = 3.6
 Identities = 9/34 (26%), Positives = 17/34 (50%)
 Frame = -3

Query: 309 SXXVRGASLGNGDSVTSXAIAXXIWVWRXTXHLT 208
           S   R +++ +GD +T   +   + VWR    +T
Sbjct: 169 SIEARDSAIFDGDFITENNLPLGLEVWRDKVFIT 202


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 20.6 bits (41), Expect = 8.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +2

Query: 359 KSSGGCSLSWF 391
           +SSGG  L WF
Sbjct: 59  ESSGGVELGWF 69


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,113
Number of Sequences: 438
Number of extensions: 1717
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11820384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)