BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0196 (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26130.1 68418.m03108 pathogenesis-related protein, putative ... 30 0.83 At5g08010.1 68418.m00932 expressed protein condensin subunit SMC... 27 4.4 >At5g26130.1 68418.m03108 pathogenesis-related protein, putative similar to PR-1a protein [Nicotiana tabacum] GI:19944; contains Pfam profile PF00188: SCP-like extracellular protein Length = 164 Score = 29.9 bits (64), Expect = 0.83 Identities = 22/85 (25%), Positives = 34/85 (40%) Frame = -3 Query: 351 AVPRRGAKXNAXSTSXXVRGASLGNGDSVTSXAIAXXIWVWRXTXHLTTASNGSDSSSRG 172 A R+G S S + G +L S A A +WV + ++ ++ SD G Sbjct: 62 AQQRKGDCSLTHSNSNGLYGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCSDGKQCG 121 Query: 171 TEYSTTCRTARRAYSKARMACDTGG 97 RT+ A++ CD GG Sbjct: 122 HYTQVVWRTSEWV-GCAKVKCDNGG 145 >At5g08010.1 68418.m00932 expressed protein condensin subunit SMC4, Drosophila melanogaster, EMBL:AF186472 Length = 566 Score = 27.5 bits (58), Expect = 4.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 28 SIPKFHSSLQDLKQPSLQXPRCLATRV 108 ++ K SS +DL L+ PRCLA+ V Sbjct: 21 NVSKGKSSSEDLTNVKLESPRCLASNV 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,932,449 Number of Sequences: 28952 Number of extensions: 110377 Number of successful extensions: 319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -