BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0195 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 25 0.27 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 25 0.27 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 25.4 bits (53), Expect = 0.27 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 435 VTILSGQSPTFPNIRTTNSEQPPELLKTAVPRRGAKLNARSTS 307 ++ L G+ P I + +PPEL + GA+ NA STS Sbjct: 20 ISCLKGKMPIDLVIDERDGGKPPELTGSTNGDGGARSNADSTS 62 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 25.4 bits (53), Expect = 0.27 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 435 VTILSGQSPTFPNIRTTNSEQPPELLKTAVPRRGAKLNARSTS 307 ++ L G+ P I + +PPEL + GA+ NA STS Sbjct: 176 ISCLKGKMPIDLVIDERDGGKPPELTGSTNGDGGARSNADSTS 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,633 Number of Sequences: 336 Number of extensions: 1663 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -