BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0191 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 25 1.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 4.4 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 25.0 bits (52), Expect = 1.4 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +2 Query: 359 PSSVKS--FPGDGKS-DSRQVRYXAAVHDVLPEAIGRCGHRRVXG 484 PSS S GDG + D++Q VH + P I CGHR G Sbjct: 80 PSSTASPTTAGDGDANDTQQASKRPPVH-IPPYEIEGCGHRNPHG 123 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 426 AASYRTCRESLLPSPGNDFTLEGNDTCS 343 A + C E PS G L+ N TC+ Sbjct: 749 ADCFNHCLEVYRPSSGGAVALQSNGTCA 776 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 458,283 Number of Sequences: 2352 Number of extensions: 9634 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -