BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesS0190
(399 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q50FS7 Cluster: Cj81-103; n=7; Campylobacter jejuni|Rep... 32 4.8
>UniRef50_Q50FS7 Cluster: Cj81-103; n=7; Campylobacter jejuni|Rep:
Cj81-103 - Campylobacter jejuni
Length = 155
Score = 31.9 bits (69), Expect = 4.8
Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
Frame = -3
Query: 172 YFXSLEEYTISKTLRLFISSKL*F-INNTLNMYIFMTLIYGMNLNYIMCIIYGDEYE 5
YF +EE +K L F+ K F +NN N+ I +I+G YI+ +I +E
Sbjct: 68 YFLDMEELMPNKILSTFVDLKFKFKLNNIDNLEIMQNIIFG-PYRYILPLIINFSFE 123
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 295,984,753
Number of Sequences: 1657284
Number of extensions: 4027272
Number of successful extensions: 5569
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5448
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5569
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16926675320
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -