Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0190
         (399 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q50FS7 Cluster: Cj81-103; n=7; Campylobacter jejuni|Rep...    32   4.8  

>UniRef50_Q50FS7 Cluster: Cj81-103; n=7; Campylobacter jejuni|Rep:
           Cj81-103 - Campylobacter jejuni
          Length = 155

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = -3

Query: 172 YFXSLEEYTISKTLRLFISSKL*F-INNTLNMYIFMTLIYGMNLNYIMCIIYGDEYE 5
           YF  +EE   +K L  F+  K  F +NN  N+ I   +I+G    YI+ +I    +E
Sbjct: 68  YFLDMEELMPNKILSTFVDLKFKFKLNNIDNLEIMQNIIFG-PYRYILPLIINFSFE 123


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 295,984,753
Number of Sequences: 1657284
Number of extensions: 4027272
Number of successful extensions: 5569
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5448
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5569
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16926675320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)