BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0189 (610 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.1 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.4 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 105 PFCISHTKTSFPFTXTRPTIVIGLTPAVCAI 13 P S T T+ P T T+ TIV + C++ Sbjct: 321 PVLSSSTTTTSPMTSTKSTIVRNHLNSTCSV 351 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 243 TPMLENNVLHIIDIYLENLV*SLXLCYQH 329 +P E+ VLH + + LE+ L LC H Sbjct: 1073 SPNDEDFVLHSLAVELEHGAAGLRLCLHH 1101 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = -3 Query: 281 IYNVQHVVLQHWGKFRXEYVQGFPVKXTNRISTLSPIFF 165 ++N HV + + Y++ F V + + PIF+ Sbjct: 364 LHNFGHVAISYIHDPDHRYLESFGVMGDSATAMRDPIFY 402 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,230 Number of Sequences: 438 Number of extensions: 2965 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -