BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0180 (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1D2F5 Cluster: Putative lipoprotein; n=1; Myxococcus x... 35 0.88 UniRef50_A6CR92 Cluster: Adaptor protein; n=1; Bacillus sp. SG-1... 33 2.7 UniRef50_Q6IR95 Cluster: MGC80043 protein; n=1; Xenopus laevis|R... 33 4.7 UniRef50_Q4SVA9 Cluster: Chromosome undetermined SCAF13769, whol... 33 4.7 UniRef50_O25792 Cluster: Pyrimidine nucleoside transport protein... 33 4.7 UniRef50_A6QNT4 Cluster: FAM120B protein; n=3; Laurasiatheria|Re... 33 4.7 UniRef50_Q822Y4 Cluster: Probable O-sialoglycoprotein endopeptid... 33 4.7 UniRef50_O00159 Cluster: Myosin-Ic; n=144; root|Rep: Myosin-Ic -... 32 6.2 UniRef50_Q4XLD0 Cluster: CIR protein, putative; n=2; Plasmodium ... 32 8.2 >UniRef50_Q1D2F5 Cluster: Putative lipoprotein; n=1; Myxococcus xanthus DK 1622|Rep: Putative lipoprotein - Myxococcus xanthus (strain DK 1622) Length = 558 Score = 35.1 bits (77), Expect = 0.88 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 94 LVLPALSAEDVSYQACVDKYSRKGYQPWQEWSDHY-TCHRY-RCEIRDGKYFIAAVDVEN 267 +V PAL+A +CV+ Y G W WS+ + TC Y E+ DG F+ AV VE+ Sbjct: 72 VVSPALAAS----LSCVETYVNAGTCDWAHWSEMWETCETYEHPELEDG-VFLEAVQVED 126 >UniRef50_A6CR92 Cluster: Adaptor protein; n=1; Bacillus sp. SG-1|Rep: Adaptor protein - Bacillus sp. SG-1 Length = 184 Score = 33.5 bits (73), Expect = 2.7 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +1 Query: 100 LPALSAEDVSYQACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKYFIAAVDVENQKYR 279 L LS+ V + +D+ KG +W D H + E+ D Y +D+E+ Sbjct: 3 LERLSSNTVKFSISIDELETKGILKDDQWRDSLVWHEFFEELMDEMYSEYGIDLESTV-- 60 Query: 280 KTHWNATNTSKM 315 N+ N+S+M Sbjct: 61 TVEINSVNSSEM 72 >UniRef50_Q6IR95 Cluster: MGC80043 protein; n=1; Xenopus laevis|Rep: MGC80043 protein - Xenopus laevis (African clawed frog) Length = 513 Score = 32.7 bits (71), Expect = 4.7 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +3 Query: 222 DQRREILHSCCGCRKPKIPENALEC-HEYIEDENVEFPTCCARLRCVVEVNGERIVQTRG 398 D +++LH+ P IPE AL C ++ E V+ R+RC + + E I +TR Sbjct: 43 DDHQQLLHTFSYFPYPSIPEIALLCMRNGLQMEKVKSWFMVQRIRCGISWSSEEIEETRS 102 Query: 399 Q 401 + Sbjct: 103 R 103 >UniRef50_Q4SVA9 Cluster: Chromosome undetermined SCAF13769, whole genome shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome undetermined SCAF13769, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 556 Score = 32.7 bits (71), Expect = 4.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 388 KPEGSLANCSPINHGRGQQNEPNP 459 +P + C I H R QQNEPNP Sbjct: 489 RPSADVGKCRMIRHERDQQNEPNP 512 >UniRef50_O25792 Cluster: Pyrimidine nucleoside transport protein; n=31; Bacteria|Rep: Pyrimidine nucleoside transport protein - Helicobacter pylori (Campylobacter pylori) Length = 418 Score = 32.7 bits (71), Expect = 4.7 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 470 PTTAGFGSFCWPLPWFIGEQFARLPSGLHYSLSIYFDDATQSRTA 336 P AG+ S PLP+ I F P GL ++ IY + T S A Sbjct: 188 PVLAGYASMGIPLPYLIAASFMSAPGGLLFAKIIYPQNETISSHA 232 >UniRef50_A6QNT4 Cluster: FAM120B protein; n=3; Laurasiatheria|Rep: FAM120B protein - Bos taurus (Bovine) Length = 700 Score = 32.7 bits (71), Expect = 4.7 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -1 Query: 427 GLSGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNS 323 GL G + CP VCT+++ F +R+R+QH G + Sbjct: 5 GLHGFVASSCPHVCTVVN-FKELAERHRSQHPGGT 38 >UniRef50_Q822Y4 Cluster: Probable O-sialoglycoprotein endopeptidase; n=7; Chlamydiaceae|Rep: Probable O-sialoglycoprotein endopeptidase - Chlamydophila caviae Length = 344 Score = 32.7 bits (71), Expect = 4.7 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = +3 Query: 255 GCRKPKIPENALECH---EYIEDENVEFP 332 GC+KP I N +E H Y+E ENVEFP Sbjct: 100 GCQKPIIGVNHVEAHLYAAYMEAENVEFP 128 >UniRef50_O00159 Cluster: Myosin-Ic; n=144; root|Rep: Myosin-Ic - Homo sapiens (Human) Length = 1028 Score = 32.3 bits (70), Expect = 6.2 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >UniRef50_Q4XLD0 Cluster: CIR protein, putative; n=2; Plasmodium chabaudi|Rep: CIR protein, putative - Plasmodium chabaudi Length = 310 Score = 31.9 bits (69), Expect = 8.2 Identities = 35/150 (23%), Positives = 67/150 (44%), Gaps = 3/150 (2%) Frame = +1 Query: 37 GVLRIQHGKQLGALFMLCCLVLPALSAEDVSYQA--CVDKYSRKGYQPWQEWSDHYTCHR 210 G+++I + L L+ L + A++ D A C+ KY+ K +QE++ T R Sbjct: 122 GMMKI-YFSYLNKLYALLKGICDAINKCDYPSNADECI-KYANKCANLYQEYAK--TGPR 177 Query: 211 YRCEIRDGKYFIAAVDVENQKYRKTHWNATNTSKMRMSNSPRAVRD-CVASSK*MERE*C 387 Y ++ + + K+R+T+ N + ++++ + + C + + + E Sbjct: 178 YHEYCNPYCNVLSNLKSDYDKFRETNNNKNDLPELKLLDGGESCESFCKSKRQKLNAEKA 237 Query: 388 KPEGSLANCSPINHGRGQQNEPNPAVVGMS 477 KPE S SP N GQ ++ P G S Sbjct: 238 KPEDSKIVTSPTNSLSGQPSDILPGNQGYS 267 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,557,858 Number of Sequences: 1657284 Number of extensions: 11740487 Number of successful extensions: 36234 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 35058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36200 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -