BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0180 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) 29 2.8 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_35270| Best HMM Match : Jacalin (HMM E-Value=8.6) 27 6.5 SB_24494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_23919| Best HMM Match : Nanovirus_C8 (HMM E-Value=7.2) 27 6.5 >SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.5 bits (63), Expect = 1.6 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 252 CGCRKPKIPENALECHEYIEDENVEFPTCCARLRC 356 C +KP +P++ HE + + C R RC Sbjct: 28 CLAQKPGVPQDTRHSHEPLPQRKISLIVCSTRTRC 62 >SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 119 SADRAGKTRQHNINNAPNCFPCCIL 45 SA+ K R H+ N +CF CCIL Sbjct: 279 SANDKKKKRLHDSANQKSCFTCCIL 303 >SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) Length = 1188 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 270 KIPENALECHEYIEDENVEFPT 335 ++ E+ LEC EYI ++N EF T Sbjct: 513 EMSESILECFEYIPEKNTEFMT 534 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPTCC 341 QRRE + G K E H+ D NV F CC Sbjct: 731 QRREGFKTAEGSEARKQDERRFRLHQSSSDSNVYFSQCC 769 >SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1593 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 214 RCEIRDGKYFIAAVDVENQKYRKTHWNATNTSK 312 +C I G+Y+I + Q++R WNA +T++ Sbjct: 497 QCNIIHGRYYIFHHKKDVQRHRYLVWNANDTTR 529 >SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 248 LLWMSKTKNTGKRTGM--PRIHRR*ECRIPHVLCAIALRRRSKWRENS 385 L W + KN GKR G+ P + R C + +A R R WREN+ Sbjct: 17 LSWNPEYKNPGKRNGIRNPEPYWR-SCH-EAMTYPLATRHRQIWRENA 62 >SB_35270| Best HMM Match : Jacalin (HMM E-Value=8.6) Length = 211 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 121 DVSYQACVDKYSRKGYQPWQEWSDHYT 201 D SY D+ GY WQ W+D +T Sbjct: 144 DGSYPKPHDEALEAGYDSWQAWADAWT 170 >SB_24494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 272 NTGKRTGMPRIHRR*ECRIPHVLCAIA 352 + GK G IH R +CR P LC +A Sbjct: 373 SNGKLMGTIDIHSRRKCRNPRSLCVVA 399 >SB_23919| Best HMM Match : Nanovirus_C8 (HMM E-Value=7.2) Length = 308 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 216 MRDQRREILHSCCGCRKPKIPENAL 290 MR++R I+ +C C P P+N + Sbjct: 1 MRERRENIVRACENCETPSSPKNTM 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,480,274 Number of Sequences: 59808 Number of extensions: 384817 Number of successful extensions: 1116 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1116 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -