BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0178 (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa... 25 6.3 SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosac... 25 6.3 >SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 25.0 bits (52), Expect = 6.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 302 LHNLSSANVTPTYVHNLPXGIHLXNIARKFXH 207 L+ + N T YVH LP I + F H Sbjct: 167 LNQFTDPNNTAVYVHQLPENITTQELRSYFLH 198 >SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosaccharomyces pombe|chr 1|||Manual Length = 614 Score = 25.0 bits (52), Expect = 6.3 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 377 PPFPPTIDWSPGXGTFRKI*SRLXXLHNLSSANVTPTYV 261 PP PP+++ S G + I S+ + + + TP Y+ Sbjct: 157 PPIPPSVEASSGQNFNQGIASQNPAISTSNLPSTTPLYI 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,832,431 Number of Sequences: 5004 Number of extensions: 31451 Number of successful extensions: 50 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -