BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0177 (482 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29060.1 68415.m03532 scarecrow transcription factor family p... 29 1.6 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 28 2.9 At1g09060.2 68414.m01011 transcription factor jumonji (jmjC) dom... 28 2.9 At1g09060.1 68414.m01010 transcription factor jumonji (jmjC) dom... 28 2.9 At5g08010.1 68418.m00932 expressed protein condensin subunit SMC... 28 3.8 At3g55630.3 68416.m06181 dihydrofolate synthetase/folylpolygluta... 28 3.8 At3g55630.2 68416.m06180 dihydrofolate synthetase/folylpolygluta... 28 3.8 At3g55630.1 68416.m06179 dihydrofolate synthetase/folylpolygluta... 28 3.8 At4g03430.1 68417.m00470 pre-mRNA splicing factor-related simila... 27 5.0 At5g19560.1 68418.m02329 hypothetical protein contains Pfam prof... 27 8.8 At4g10350.1 68417.m01700 no apical meristem (NAM) family protein... 27 8.8 At4g09960.2 68417.m01630 MADS-box protein (AGL11) 27 8.8 >At2g29060.1 68415.m03532 scarecrow transcription factor family protein Length = 1336 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +2 Query: 239 MRTAMAV*SHAVSVPERRSSDEYGRXARVELRSASWQRGLQELWRXFA 382 +RT + + AVS+ +RR++DE +R+ S+S+ G + L FA Sbjct: 318 LRTMLVSCAQAVSINDRRTADEL--LSRIRQHSSSYGDGTERLAHYFA 363 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 234 VWRLTDHLTTASNGSDSSSRGTEYSTT 154 +W + DH+T A GSDS S G+ + T Sbjct: 235 LWNIQDHITMA--GSDSKSPGSSFKQT 259 >At1g09060.2 68414.m01011 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 930 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 466 TRKRKHRSNSELQYXAAIADIS 401 TR R H+S S ++Y AA D+S Sbjct: 177 TRNRSHQSTSPMEYSAASTDVS 198 >At1g09060.1 68414.m01010 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 930 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 466 TRKRKHRSNSELQYXAAIADIS 401 TR R H+S S ++Y AA D+S Sbjct: 177 TRNRSHQSTSPMEYSAASTDVS 198 >At5g08010.1 68418.m00932 expressed protein condensin subunit SMC4, Drosophila melanogaster, EMBL:AF186472 Length = 566 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 28 SIPKFHSSLQDLKQPSLQEPRCLATRV 108 ++ K SS +DL L+ PRCLA+ V Sbjct: 21 NVSKGKSSSEDLTNVKLESPRCLASNV 47 >At3g55630.3 68416.m06181 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS4) nearly identical to folylpolyglutamate-dihydrofolate synthetase [Arabidopsis thaliana] GI:17976761 Length = 492 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 269 AVSVPERRSSDEYGRXARVELR--SASWQRGLQELWRXFA 382 AV VP ++ G V R S SWQ GLQ +W A Sbjct: 388 AVFVPNVSVYNQVGSSTNVGTRVESMSWQFGLQRIWESLA 427 >At3g55630.2 68416.m06180 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS4) nearly identical to folylpolyglutamate-dihydrofolate synthetase [Arabidopsis thaliana] GI:17976761 Length = 491 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 269 AVSVPERRSSDEYGRXARVELR--SASWQRGLQELWRXFA 382 AV VP ++ G V R S SWQ GLQ +W A Sbjct: 387 AVFVPNVSVYNQVGSSTNVGTRVESMSWQFGLQRIWESLA 426 >At3g55630.1 68416.m06179 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS4) nearly identical to folylpolyglutamate-dihydrofolate synthetase [Arabidopsis thaliana] GI:17976761 Length = 470 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 269 AVSVPERRSSDEYGRXARVELR--SASWQRGLQELWRXFA 382 AV VP ++ G V R S SWQ GLQ +W A Sbjct: 366 AVFVPNVSVYNQVGSSTNVGTRVESMSWQFGLQRIWESLA 405 >At4g03430.1 68417.m00470 pre-mRNA splicing factor-related similar to pre-mRNA splicing factor pre-mRNA splicing factor prp1 (SP:Q12381) [Fission yeast] Length = 1029 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 317 ARVELRSASWQRGLQELWRXFAVVVXMLGNVGDGRXIL 430 AR+ L A + G + +W A+V LGNV + R +L Sbjct: 746 ARMLLAKARERGGTERVWMKSAIVERELGNVEEERRLL 783 >At5g19560.1 68418.m02329 hypothetical protein contains Pfam profile PF03759: Domain of unknown function (DUF315) Length = 493 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 10 KSSGTSSIPKFHSSLQDLKQPSLQEPRCLATRVTGHARL 126 K S S I FH Q+ ++P ++ PR L + + A+L Sbjct: 445 KHSSMSDIEFFHKVEQEKEKPMMKSPRALPKKFSYLAKL 483 >At4g10350.1 68417.m01700 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; nap gene, Arabidopsis thaliana, gb:AJ222713 Length = 341 Score = 26.6 bits (56), Expect = 8.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 231 WRLTDHLTTASNGSDSSSRGTEY 163 W + D L T G++ SSRG Y Sbjct: 286 WAMMDRLVTCHMGNEDSSRGITY 308 >At4g09960.2 68417.m01630 MADS-box protein (AGL11) Length = 216 Score = 26.6 bits (56), Expect = 8.8 Identities = 18/83 (21%), Positives = 34/83 (40%) Frame = -2 Query: 481 ISVYLTRKRKHRSNSELQYXAAIADISQHXNHDXEXPPELLKTALPRRGAKLNARXTSIL 302 IS ++K N + +A++ ++ H + A+ ++ N SI+ Sbjct: 135 ISRIRSKKEIELDNENIYLRTKVAEVERYQQHHHQMVSGSEINAIEALASR-NYFAHSIM 193 Query: 301 VRGASLGNGDSVTSNXHRSSHLG 233 G+ GNG S + + HLG Sbjct: 194 TAGSGSGNGGSYSDPDKKILHLG 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,154,567 Number of Sequences: 28952 Number of extensions: 139262 Number of successful extensions: 375 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -