BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0172 (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 29 0.51 SPAC1F7.08 |fio1||iron transport multicopper oxidase Fio1|Schizo... 28 0.90 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 27 1.2 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 1.2 SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 27 2.1 SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 25 4.8 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 4.8 SPAC3F10.07c |mug91||dubious|Schizosaccharomyces pombe|chr 1|||M... 25 4.8 SPBC8D2.03c |hhf2|ams3, h4.2|histone H4 h4.2|Schizosaccharomyces... 25 6.3 SPBC1105.12 |hhf3|h4.3|histone H4 h4.3|Schizosaccharomyces pombe... 25 6.3 SPBC1711.07 |||WD repeat protein Rrb1 |Schizosaccharomyces pombe... 25 6.3 SPAC1834.03c |hhf1|h4.1|histone H4 h4.1|Schizosaccharomyces pomb... 25 6.3 SPAC19D5.03 |cid1||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 8.4 SPAC1F12.07 |||phosphoserine aminotransferase |Schizosaccharomyc... 25 8.4 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 28.7 bits (61), Expect = 0.51 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 351 VHKLNRVFGEDKSELNWETIPDDVL 277 +H + EDKS+L +ETIPD VL Sbjct: 9 IHPVRHSKYEDKSKLPFETIPDPVL 33 >SPAC1F7.08 |fio1||iron transport multicopper oxidase Fio1|Schizosaccharomyces pombe|chr 1|||Manual Length = 622 Score = 27.9 bits (59), Expect = 0.90 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 35 LFYVFSWHLCMLXDSDVPNDILEEQLYNSVVVADYDSAVEK 157 +FY S H + D +D+ E L N+ + D D AVEK Sbjct: 573 IFYGASIHPVPTEELDENDDLQEAALENAAMFLDTDKAVEK 613 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.5 bits (58), Expect = 1.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 107 QLYNSVVVADYDSAVEKSKHLYEEKKS 187 QL N DY+ E++K LY+E+KS Sbjct: 184 QLQNENFKDDYEKIKEENKRLYKERKS 210 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 27.5 bits (58), Expect = 1.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 266 SRAPRTSSGIVSQLSSDLSSP-KTRLSLCTSATVS 367 S P T S + S LSS SSP T LS+ +S+T S Sbjct: 567 SSIPSTFSSVSSILSSSTSSPSSTSLSISSSSTSS 601 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.6 bits (56), Expect = 2.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 296 VSQLSSDLSSPKTRLSLCTSATV 364 VS L +DL + KT+LS SATV Sbjct: 166 VSSLLNDLDNSKTKLSFLPSATV 188 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 25.4 bits (53), Expect = 4.8 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -2 Query: 366 ETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKLKAYSMQF 235 E V +H L+ F ED+ E E I DV A++PKL S + Sbjct: 2004 ELVTTLHSLDVFFAEDRDE---ELIQPDV--AVDPKLDITSEDY 2042 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 25.4 bits (53), Expect = 4.8 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = +1 Query: 223 KQQDELHGVRLQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYQRDGLALTLSNDVQXDD 402 +++D+L V L +L+ + DCF + +++ ENA Y+ D ++ D Sbjct: 926 REEDQLSRVTLLEYLKQLHPVEWDCFVKDTKILVEENA---PYENDSVSEKEGTYKSKVD 982 Query: 403 GRPAYXDG 426 P Y G Sbjct: 983 DLPFYCIG 990 >SPAC3F10.07c |mug91||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 283 CPWSPGAKVEGVLHAVHLVVSYQFV 209 CPWS G ++G+L + + +S +FV Sbjct: 52 CPWSIGNLLDGILSVLTIYIS-EFV 75 >SPBC8D2.03c |hhf2|ams3, h4.2|histone H4 h4.2|Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 25.0 bits (52), Expect = 6.3 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 142 VVIGDDDAIVKLLLQNVVRD-VGIXQHTEMPRKDIE*L*RASSLERR 5 +V + A++KL L+NV+RD V +H + RK + L SL+R+ Sbjct: 50 LVYEETRAVLKLFLENVIRDAVTYTEHAK--RKTVTSLDVVYSLKRQ 94 >SPBC1105.12 |hhf3|h4.3|histone H4 h4.3|Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 25.0 bits (52), Expect = 6.3 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 142 VVIGDDDAIVKLLLQNVVRD-VGIXQHTEMPRKDIE*L*RASSLERR 5 +V + A++KL L+NV+RD V +H + RK + L SL+R+ Sbjct: 50 LVYEETRAVLKLFLENVIRDAVTYTEHAK--RKTVTSLDVVYSLKRQ 94 >SPBC1711.07 |||WD repeat protein Rrb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 480 Score = 25.0 bits (52), Expect = 6.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 292 PGRCPWSPGAKVEGVLHAVHLVVSYQFVHDI 200 P + PW PG K+ V Y+ +H+I Sbjct: 70 PSKIPWLPGGKINADEKLVADPSVYEMLHNI 100 >SPAC1834.03c |hhf1|h4.1|histone H4 h4.1|Schizosaccharomyces pombe|chr 1|||Manual Length = 103 Score = 25.0 bits (52), Expect = 6.3 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 142 VVIGDDDAIVKLLLQNVVRD-VGIXQHTEMPRKDIE*L*RASSLERR 5 +V + A++KL L+NV+RD V +H + RK + L SL+R+ Sbjct: 50 LVYEETRAVLKLFLENVIRDAVTYTEHAK--RKTVTSLDVVYSLKRQ 94 >SPAC19D5.03 |cid1||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 405 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 59 LCMLXDSDVPNDILEEQLYNSVVVADYD 142 LC+L DS V +D + Q Y ++ ++ Sbjct: 104 LCVLMDSRVQSDTIALQFYEELIAEGFE 131 >SPAC1F12.07 |||phosphoserine aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 24.6 bits (51), Expect = 8.4 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +2 Query: 98 LEEQLYNSVVVADYDSAVEKSKHLYEE-KKSEVITNVVNKLIRNNKMN 238 LE L + +VA S++EKSK LY+ K ++ +VV R ++MN Sbjct: 279 LEYMLEHGGLVALEASSIEKSKLLYDTLDKHDLYISVVEPAAR-SRMN 325 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,669,559 Number of Sequences: 5004 Number of extensions: 28212 Number of successful extensions: 138 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -