BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0172 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) 29 2.8 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 27 6.5 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) 27 6.5 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +3 Query: 15 KDEARYSYSMSFRGISVCXQIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAKS 194 K +S + ++ +IPTS R SFTI P + VR R S +T RR + Sbjct: 384 KTNTYFSSPSNSTSFTMVRRIPTSRVRQTRLSFTIVRRIPTSRVRQTRLS-FTMIRRIPA 442 Query: 195 SQM 203 S++ Sbjct: 443 SRV 445 Score = 28.3 bits (60), Expect = 3.7 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +3 Query: 15 KDEARYSYSMSFRGISVCXQIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAKS 194 K S S + ++ +IPTS R SFT+ P + VR R S +T RR + Sbjct: 127 KTNTYLSSSSNSTSFTMVRRIPTSRVRQTRLSFTMVRRIPTSRVRQTRLS-FTMVRRIPT 185 Query: 195 SQM 203 S++ Sbjct: 186 SRV 188 >SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +2 Query: 158 SKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAFNFGSRAPRTSSGIVSQLSSDLSSPKTR 337 S+ L +EKK E ++ + + N K + + + NF + P S +L ++ +S + Sbjct: 224 SQRLEKEKKKEWVSCIKKTEVTNRKRSLVSFLRNFATGNPFFPSFFHYELPAEEASGTST 283 Query: 338 LSLCTSATVSL 370 L T VSL Sbjct: 284 GRLITRCQVSL 294 >SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) Length = 306 Score = 28.7 bits (61), Expect = 2.8 Identities = 21/98 (21%), Positives = 46/98 (46%) Frame = +2 Query: 77 SDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAF 256 S++ +++ + NS + + + + + +E +K E+ ++++ E++ Sbjct: 36 SELREEVILLRKENSQIESTFVEKNAELRQHFEIEKEELNRKLIHEKEELRYSLEAEFSQ 95 Query: 257 NFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTSATVSL 370 F + + T SG++ QL DL KTR SA + L Sbjct: 96 KFVNESA-TQSGVIQQLDGDLRMMKTRCGELESAMLEL 132 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 27.5 bits (58), Expect = 6.5 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Frame = +2 Query: 113 YNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKL--IRNNKMNCMEYAFNFGSRAPRTS 286 ++SV +DS+V + L+E KK +++ L + + N + SR P S Sbjct: 910 FHSVGGTSWDSSVADEEDLFEVKKKPDKPSLLAALKPVARQESNASLKSNKSASRIPVRS 969 Query: 287 SGIVSQLSSDLSS---PKTRLSLCTS 355 + S +S D S P +R+ + +S Sbjct: 970 DSVKSSVSVDFKSKEPPASRIPVLSS 995 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 10/59 (16%) Frame = +1 Query: 154 KEQAFIRGEEERSHHKCREQTDTK-------QQDELHGVRLQLW---LQGSKDIVRDCF 300 K Q R EEE K +E+ T+ + D+LHG+R+ W L G +++ F Sbjct: 28 KLQEKARAEEEAKEKKRKEEDATRIAELEKPKPDKLHGLRVHCWVLVLSGKREVPESFF 86 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 27.5 bits (58), Expect = 6.5 Identities = 20/80 (25%), Positives = 31/80 (38%) Frame = +2 Query: 77 SDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAF 256 SDVP + Y + + D DSA + S KS + N V + C + Sbjct: 42 SDVPEPVAASTPYQTRELRDMDSANDGSSLKKHTDKSNMAHNAVERFSTETTSVCRSVSE 101 Query: 257 NFGSRAPRTSSGIVSQLSSD 316 S+ P +S + + SD Sbjct: 102 ESQSQEPISSVLVHDESFSD 121 >SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) Length = 453 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +2 Query: 179 KKSEVITNVVNKLIRNNKMNCMEYAFNFGSRAPRTSSGIVSQLSSD 316 K+ ++TN+ + I N++N + NF R S + +++SSD Sbjct: 214 KEKMILTNLKSPRITANQLNVYKNQINFLKRMFELQSALEAEVSSD 259 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/61 (22%), Positives = 27/61 (44%) Frame = +2 Query: 107 QLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAFNFGSRAPRTS 286 ++YNS+ Y+S K + K + + N + + N + NC+ + N + S Sbjct: 325 EIYNSLDNKIYNSLDNKIYNSLNNKINNSLDNKIYNSLDNKRYNCLNFHINTDHHSYHAS 384 Query: 287 S 289 S Sbjct: 385 S 385 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/61 (22%), Positives = 27/61 (44%) Frame = +2 Query: 107 QLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAFNFGSRAPRTS 286 ++YNS+ Y+S K + K + + N + + N + NC+ + N + S Sbjct: 418 EIYNSLDNKIYNSLDNKIYNSLNNKINNSLDNKIYNSLDNKRYNCLNFHINTDHHSYHAS 477 Query: 287 S 289 S Sbjct: 478 S 478 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,588,684 Number of Sequences: 59808 Number of extensions: 213147 Number of successful extensions: 716 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -