BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0164 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43992| Best HMM Match : BA14K (HMM E-Value=8.5) 27 8.6 SB_6061| Best HMM Match : NACHT (HMM E-Value=0.00065) 27 8.6 >SB_43992| Best HMM Match : BA14K (HMM E-Value=8.5) Length = 95 Score = 27.1 bits (57), Expect = 8.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 447 WKNRSRL*RSWWPDSRTRRSPGTSA 373 W +S + +W+PDSR+ SP +A Sbjct: 5 WSRKSDIQPAWFPDSRSAYSPRLAA 29 >SB_6061| Best HMM Match : NACHT (HMM E-Value=0.00065) Length = 879 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +3 Query: 270 PRIQEALERINFRFHRTCSFSXI--IRDXYVNXAETLLMYRGCDESESRATMSVT 428 P + E L + FR+HR + + D N T ++ D+++ R T+ + Sbjct: 140 PEVAEQLSSLVFRYHRVLPWVTVRHSHDLVCNPLHTAMLCLAFDDNKERLTLQTS 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,704,445 Number of Sequences: 59808 Number of extensions: 199230 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -