BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0163 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 1.3 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 5.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.4 bits (48), Expect = 1.3 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = +3 Query: 78 LIKNRNGQCSKTIGSSSGPCPDQKS*SYNQNCRRIVIPEKAQSKVLHGEVVAVGPGARKK 257 LI + S I S S CP S S + + + + P++ ++ ++H PG+ ++ Sbjct: 360 LINEMKKRYSALINSQS--CPITSSGSTDSSSQSVEDPQQVEAAIVHLIANLPSPGSDQR 417 Query: 258 METSSP 275 T SP Sbjct: 418 -STPSP 422 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 127 EEEPIVLLHWPFRFL 83 EE P V + PFRFL Sbjct: 485 EERPDVKIFLPFRFL 499 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 9.4 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 469 VDMVVYFCXXLILFSC 516 V + +FC L++F C Sbjct: 62 VKCLAFFCTALVIFYC 77 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.4 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 469 VDMVVYFCXXLILFSC 516 V + +FC L++F C Sbjct: 295 VKCLAFFCTALVIFYC 310 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.4 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 469 VDMVVYFCXXLILFSC 516 V + +FC L++F C Sbjct: 295 VKCLAFFCTALVIFYC 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,870 Number of Sequences: 336 Number of extensions: 2332 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -