BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0162 (399 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92784-3|CAB07194.1| 318|Caenorhabditis elegans Hypothetical pr... 27 5.0 Z81479-6|CAB03938.1| 411|Caenorhabditis elegans Hypothetical pr... 26 8.7 >Z92784-3|CAB07194.1| 318|Caenorhabditis elegans Hypothetical protein F31C3.4 protein. Length = 318 Score = 27.1 bits (57), Expect = 5.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNILLKII 125 FE+ H LH GKY +L K F Y+ I++ I Sbjct: 280 FEVIPHELHNGKYRIL-KMFFIYMGFAIVVAFI 311 >Z81479-6|CAB03938.1| 411|Caenorhabditis elegans Hypothetical protein C34F6.7 protein. Length = 411 Score = 26.2 bits (55), Expect = 8.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 80 IFHQEEILDGLGKSINELLMIL 15 +F EE+LDGLG ++ +L IL Sbjct: 49 VFPPEELLDGLGLTLFDLFTIL 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,774,980 Number of Sequences: 27780 Number of extensions: 123046 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 619699724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -