BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0162 (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 1.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 1.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 3.9 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 5.2 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 5.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 5.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 20 9.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 20 9.1 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 20 9.1 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 20 9.1 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 223 FELFNHSLHFGKYNLLYKKLFQYLLCNI 140 ++ N++ + YN YKKL Y + NI Sbjct: 89 YKYSNYNNYNNNYNTNYKKLQYYNIINI 116 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 211 NHSLHFGKYNLLYKKLFQYLLCNI 140 N++ + YN YKKL Y + NI Sbjct: 97 NYNNYNNNYNTNYKKLQYYNIINI 120 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +1 Query: 136 TIYYTANIEIAFYRVNYICRNVNY 207 T++YT N+ + ++++C V Y Sbjct: 233 TLFYTVNLILPTVLISFLCVLVFY 256 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 5.2 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 60 YFFLMKYRIPTSFMSNNSNYYWI--IFNNILHSKY*NSFL*SKL 185 ++F++ + P +SN+ N+ I F LH + N + +L Sbjct: 231 FYFMLNHNYPPFMLSNSLNFPQIRGEFYFFLHKQVLNRYYLERL 274 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.0 bits (42), Expect = 5.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 130 FLTIYYTANIEIAFYRVNYICR 195 F+ +Y+A+ +AF+R+ CR Sbjct: 357 FIYAFYSADFRLAFWRLT--CR 376 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 5.2 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 60 YFFLMKYRIPTSFMSNNSNYYWI--IFNNILHSKY*NSFL*SKL 185 ++F++ + P +SN+ N+ I F LH + N + +L Sbjct: 231 FYFMLNHNYPPFMLSNSLNFPQIRGEFYFFLHKQVLNRYYLERL 274 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 190 KYNLLYKKLFQYLLCNILL 134 K +LL+K+ F Y L I + Sbjct: 232 KVDLLFKREFSYYLIQIYI 250 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 190 KYNLLYKKLFQYLLCNILL 134 K +LL+K+ F Y L I + Sbjct: 232 KVDLLFKREFSYYLIQIYI 250 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 187 YNLLYKKLFQYLLCNI 140 YN YKKL++ + NI Sbjct: 109 YNNNYKKLYKNYIINI 124 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 187 YNLLYKKLFQYLLCNI 140 YN YKKL++ + NI Sbjct: 109 YNNNYKKLYKNYIINI 124 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,631 Number of Sequences: 438 Number of extensions: 1971 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -