BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0159 (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-85... 29 1.8 07_03_0423 + 18035688-18036572,18036659-18036978,18052618-180527... 28 4.3 02_05_0352 + 28240913-28241362 28 4.3 03_02_0928 + 12464325-12464498,12466494-12466679,12466929-124670... 27 7.5 09_01_0020 + 413723-413738,413867-413934,414849-415144,415275-41... 27 9.9 >07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-853369, 853466-853555,853730-853837,853897-853932,853933-854022 Length = 481 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 240 YRFGSGTLKTAFDLMTTSLSSLGXKNPISAAIAS 139 +R G T AFD MT +S+ NP+ AA++S Sbjct: 72 FRGGVATRSVAFDEMTPRRASVDVPNPLRAALSS 105 >07_03_0423 + 18035688-18036572,18036659-18036978,18052618-18052724, 18053001-18053104,18054129-18054328,18054422-18054522, 18054695-18054841,18055007-18055166,18055287-18055368, 18056070-18056336,18056846-18056973,18057513-18057672 Length = 886 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 193 SHQVERSLQGPGTKSIYSRIIVSLCHSSLGADRVSKLLLDVSPTKFVFLAQTPFV 357 S +++ + G T + Y R VSL + LGA V K + K T FV Sbjct: 521 SKEIDIIVNGAATTNFYERYDVSLASNVLGAKYVCKFAKKCANLKMFLHISTAFV 575 >02_05_0352 + 28240913-28241362 Length = 149 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = +3 Query: 54 RPASTWIRRNRDTRPLLDTSS----TSP-IIGIRKLLQPKSDSXTQDLI 185 R STW +R +RP + T+S T P ++G+RK +P+ + T +L+ Sbjct: 73 RTCSTWTSLSRTSRPTMATTSGVVKTLPELVGLRK--EPRWEDKTTELL 119 >03_02_0928 + 12464325-12464498,12466494-12466679,12466929-12467021, 12467212-12467394,12467506-12467608,12467695-12467865, 12468086-12469084,12469178-12469254,12469485-12470337, 12470878-12471000,12471526-12471878 Length = 1104 Score = 27.5 bits (58), Expect = 7.5 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = +1 Query: 235 SIYSRIIVSLCHSSLGADRVSKLLLDVSPTKFVFLAQTPFVKVIDLEGTVDVQSKAKTQ- 411 + YS + +L +S G ++ ++V+ + + +P + ++DL G +D+Q + Q Sbjct: 496 TFYSSLANNLEYSKSGQSDMTNSSINVAHEEKQKFSPSP-LSLVDLSGDLDLQLRCLRQV 554 Query: 412 QAKLRFKLLEGKXVSVQALAKDFPVFR 492 Q L + + +G SVQ + D V R Sbjct: 555 QYHLEY-MFDGFLQSVQEASSDCKVAR 580 >09_01_0020 + 413723-413738,413867-413934,414849-415144,415275-415400, 415484-415566,416514-416628,416755-416847,416963-417021, 417609-417684,417812-417901,418050-418202,418294-418480, 418752-418839,419077-419125,419233-419329 Length = 531 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 20 TSSDSPYIFSGEACLDLDKKKQG 88 TSSD YIF+G D+++K +G Sbjct: 392 TSSDERYIFTGALETDIEQKNRG 414 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,695,443 Number of Sequences: 37544 Number of extensions: 288713 Number of successful extensions: 648 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -