BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0158 (397 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Sc... 26 1.8 SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual 25 4.3 >SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1573 Score = 26.2 bits (55), Expect = 1.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 143 LVAPVLGFSSAGIAAGKHSRCCTSILRKF 229 + P+LG + + G H CT IL F Sbjct: 8 ITVPILGKDTVRVGFGIHQYICTEILENF 36 >SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual Length = 653 Score = 25.0 bits (52), Expect = 4.3 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -3 Query: 191 FLPLFPLS*NRAREXLMESTDPQCXILQHRRPXLPLMQLEAPCSXNFCXLRAIR 30 FL L PLS ++ + ++P+ +QH++ L ++L P R++R Sbjct: 139 FLSLEPLSLLLLKDSFINKSNPEYESMQHQQILLKKLKLHFPRRKENSWKRSLR 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,124,574 Number of Sequences: 5004 Number of extensions: 14627 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 132093910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -