BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0158 (397 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0338 + 7426999-7428322,7428390-7428646 28 2.4 02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475,290... 27 5.5 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 28.3 bits (60), Expect = 2.4 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -3 Query: 146 LMESTDPQCXILQHRRPXLPLMQLEAPCSXNFCXLRAIRRYKSYY 12 LM C L HR P L + L A L+AI KSYY Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYY 441 >02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475, 2907650-2907790,2907870-2908043,2908577-2908851, 2909592-2909755,2910409-2910536,2910628-2910734, 2911747-2911880,2912266-2912441,2912530-2914257, 2915084-2915239,2915328-2915486,2915581-2915751, 2915931-2916047,2916417-2916473,2916565-2916680, 2916790-2916916,2917862-2917945 Length = 2056 Score = 27.1 bits (57), Expect = 5.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 280 GXYHGSXSHCDTMLP 236 G +HG SHC T+LP Sbjct: 208 GFHHGGTSHCRTLLP 222 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,885,956 Number of Sequences: 37544 Number of extensions: 113585 Number of successful extensions: 217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 217 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -