BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0156 (319 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL161622-2|CAI20456.1| 510|Homo sapiens protein ( vel protein s... 29 3.0 D64154-1|BAA11023.1| 407|Homo sapiens Mr 110,000 antigen protein. 28 5.2 BC017245-1|AAH17245.1| 407|Homo sapiens adhesion regulating mol... 28 5.2 BC010733-1|AAH10733.1| 296|Homo sapiens Unknown (protein for IM... 28 5.2 AL354836-4|CAC22308.1| 407|Homo sapiens adhesion regulating mol... 28 5.2 >AL161622-2|CAI20456.1| 510|Homo sapiens protein ( vel protein similar to seven ).). Length = 510 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 62 YVGIPYSYYLNTGSVI-FLSFELLTYLHLKDKNELRRFCTGVRRQSFAQNEF 214 Y + Y+ N VI F +E L Y + +++LRR C+G S+ + + Sbjct: 168 YAMVQQKYFSNYSPVIGFYVYEPLEYWNSSVQDDLRRLCSGFTAVSWVEQYY 219 >D64154-1|BAA11023.1| 407|Homo sapiens Mr 110,000 antigen protein. Length = 407 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 245 QNHITSPEIYQPVGPYSPAILAGQ 316 QN +TSP+ Q +G +S A+ +GQ Sbjct: 328 QNTLTSPQFQQALGMFSAALASGQ 351 >BC017245-1|AAH17245.1| 407|Homo sapiens adhesion regulating molecule 1 protein. Length = 407 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 245 QNHITSPEIYQPVGPYSPAILAGQ 316 QN +TSP+ Q +G +S A+ +GQ Sbjct: 328 QNTLTSPQFQQALGMFSAALASGQ 351 >BC010733-1|AAH10733.1| 296|Homo sapiens Unknown (protein for IMAGE:3897044) protein. Length = 296 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 245 QNHITSPEIYQPVGPYSPAILAGQ 316 QN +TSP+ Q +G +S A+ +GQ Sbjct: 217 QNTLTSPQFQQALGMFSAALASGQ 240 >AL354836-4|CAC22308.1| 407|Homo sapiens adhesion regulating molecule 1 protein. Length = 407 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 245 QNHITSPEIYQPVGPYSPAILAGQ 316 QN +TSP+ Q +G +S A+ +GQ Sbjct: 328 QNTLTSPQFQQALGMFSAALASGQ 351 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,332,151 Number of Sequences: 237096 Number of extensions: 897057 Number of successful extensions: 1570 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1570 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1511340428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -