BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0156 (319 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 3.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 20 8.3 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 3.6 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 206 FGRNFVFGRQCRIFGAHFYPLDVNRSIVQM 117 +G F C + H+YPLD V++ Sbjct: 151 YGMRFTTTLAC-MMDLHYYPLDSQNCTVEI 179 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 19.8 bits (39), Expect = 8.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 101 SVIFLSFELLTYLHLKDKNELRRFCTGVRRQSFAQNE 211 +VIF+S + + +K KN+ R Q AQ E Sbjct: 767 AVIFISVQAPPHFEIKLKNQTARRGEPAVLQCEAQGE 803 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,170 Number of Sequences: 438 Number of extensions: 1899 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6844365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -