BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0148 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 24 1.2 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 6.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 6.2 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 8.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.2 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 8 GAIGPIGANSVSSGLSWEQHPVLSRASSVPAHRALAGLL 124 G+ GP N VS +SWE H ++ + + + GL+ Sbjct: 38 GSYGPEAGN-VSCSVSWEVHDPVTNSDTYIGFLFVLGLI 75 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 166 TGSSATSHKSLQDR 207 T +S T+HKSLQ R Sbjct: 47 TKNSLTTHKSLQHR 60 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 156 PPVNRLLRHQPQVATRPXSADRL 224 PP LLR+ +AT P +L Sbjct: 827 PPTPNLLRYFASIATNPKEQAQL 849 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 190 CGWWRRSRFTGG 155 CGW SR GG Sbjct: 153 CGWKNPSRIVGG 164 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 347 PTEWKVR 327 PTEWKVR Sbjct: 582 PTEWKVR 588 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,579 Number of Sequences: 438 Number of extensions: 3112 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -