BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0141 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 1.0 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 7.3 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 7.3 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.2 bits (50), Expect = 1.0 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +2 Query: 35 FVHLSKQKQTQDKMCDRKAVIKNADMSEEMQQD--AVDCATQALEKFNIEKDIA-AFIKK 205 F+ + KQK +D D+KA+ K E+ ++D +V T +E + D + + Sbjct: 68 FIKMVKQKHKKDIRADKKALQKLRREVEKAKRDLSSVHKTTLTIENLLADYDFSETLTRA 127 Query: 206 EFDKKYN 226 +F++ N Sbjct: 128 KFEELNN 134 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 220 IQSYLALHRGSYFGSYVTHETRHFIY 297 + S+L L RGS V + F Y Sbjct: 342 VPSFLKLQRGSDISKLVAKNIKEFYY 367 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 220 IQSYLALHRGSYFGSYVTHETRHFIY 297 + S+L L RGS V + F Y Sbjct: 342 VPSFLKLQRGSDISKLVAKNIKEFYY 367 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,442 Number of Sequences: 336 Number of extensions: 3026 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -