BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0128 (698 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF144094-1|AAF05903.1| 3530|Homo sapiens unconventional myosin-1... 32 1.7 BC018708-1|AAH18708.1| 434|Homo sapiens zinc finger CCCH-type c... 31 4.0 AK027357-1|BAB55059.1| 434|Homo sapiens protein ( Homo sapiens ... 31 4.0 L12141-1|AAA58477.1| 347|Homo sapiens fork head-related protein... 30 6.9 D83776-1|BAA12105.1| 1516|Homo sapiens KIAA0191 protein. 30 9.1 BC131734-1|AAI31735.1| 1645|Homo sapiens zinc finger, CCHC domai... 30 9.1 AL138849-1|CAI23476.1| 1644|Homo sapiens zinc finger, CCHC domai... 30 9.1 AK128234-1|BAC87344.1| 167|Homo sapiens protein ( Homo sapiens ... 30 9.1 >AF144094-1|AAF05903.1| 3530|Homo sapiens unconventional myosin-15 protein. Length = 3530 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNL 398 PKP L+P L +P +P++P+ + L Q + PET+ S L Sbjct: 2518 PKP--LAPAPLAKAPRLPIKPVAAPVLAQDQASPETTSPSPEL 2558 >BC018708-1|AAH18708.1| 434|Homo sapiens zinc finger CCCH-type containing 10 protein. Length = 434 Score = 31.1 bits (67), Expect = 4.0 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 6/51 (11%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPV-----QPLTSLTLTQTASGPETSP-ASDNLSV 404 P P ++P+ + V+PV PV QPL +T++ T + T P AS ++ + Sbjct: 379 PPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRI 429 >AK027357-1|BAB55059.1| 434|Homo sapiens protein ( Homo sapiens cDNA FLJ14451 fis, clone HEMBB1001834. ). Length = 434 Score = 31.1 bits (67), Expect = 4.0 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 6/51 (11%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPV-----QPLTSLTLTQTASGPETSP-ASDNLSV 404 P P ++P+ + V+PV PV QPL +T++ T + T P AS ++ + Sbjct: 379 PPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRI 429 >L12141-1|AAA58477.1| 347|Homo sapiens fork head-related protein protein. Length = 347 Score = 30.3 bits (65), Expect = 6.9 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 267 WPKPPELSPIYLPVSPVMPVQPLTS-LTLTQTASG-PETSPASDNLSVP 407 W PE +Y PV+PV + PL S +TL +S P PAS S P Sbjct: 15 WSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPGGLPASPLPSGP 63 >D83776-1|BAA12105.1| 1516|Homo sapiens KIAA0191 protein. Length = 1516 Score = 29.9 bits (64), Expect = 9.1 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +3 Query: 198 ILNVQEILKDMASQGDYASKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPET 377 ++N Q++ QGD + + ++ + E SP Y P P S +TQ +S P + Sbjct: 1266 LVNAQQVAGSAQQQGDQSIRTRQSSECSE-SPSYSPQPQPFPQNSSQSAAITQPSSQPGS 1324 Query: 378 SP 383 P Sbjct: 1325 QP 1326 >BC131734-1|AAI31735.1| 1645|Homo sapiens zinc finger, CCHC domain containing 11 protein. Length = 1645 Score = 29.9 bits (64), Expect = 9.1 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +3 Query: 198 ILNVQEILKDMASQGDYASKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPET 377 ++N Q++ QGD + + ++ + E SP Y P P S +TQ +S P + Sbjct: 1395 LVNAQQVAGSAQQQGDQSIRTRQSSECSE-SPSYSPQPQPFPQNSSQSAAITQPSSQPGS 1453 Query: 378 SP 383 P Sbjct: 1454 QP 1455 >AL138849-1|CAI23476.1| 1644|Homo sapiens zinc finger, CCHC domain containing 11 protein. Length = 1644 Score = 29.9 bits (64), Expect = 9.1 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +3 Query: 198 ILNVQEILKDMASQGDYASKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPET 377 ++N Q++ QGD + + ++ + E SP Y P P S +TQ +S P + Sbjct: 1394 LVNAQQVAGSAQQQGDQSIRTRQSSECSE-SPSYSPQPQPFPQNSSQSAAITQPSSQPGS 1452 Query: 378 SP 383 P Sbjct: 1453 QP 1454 >AK128234-1|BAC87344.1| 167|Homo sapiens protein ( Homo sapiens cDNA FLJ46368 fis, clone TESTI4051504. ). Length = 167 Score = 29.9 bits (64), Expect = 9.1 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +3 Query: 252 SKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASD 392 S H R P P + + S V PV +T T T PE PA D Sbjct: 19 SFHPRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHD 65 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,207,277 Number of Sequences: 237096 Number of extensions: 2137837 Number of successful extensions: 7702 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 6979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7680 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -