BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0127 (449 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 103 7e-23 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 35 0.027 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 35 0.036 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 32 0.25 SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 30 1.0 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 29 1.3 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 29 1.3 SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6) 29 1.8 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_34202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_34804| Best HMM Match : rve (HMM E-Value=1.2e-24) 28 3.1 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) 28 4.1 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 27 5.4 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 27 5.4 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 27 5.4 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 27 5.4 SB_14341| Best HMM Match : DUF1339 (HMM E-Value=4.4) 27 5.4 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 27 5.4 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 27 7.2 SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) 27 9.5 SB_10758| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 27 9.5 SB_44405| Best HMM Match : Extensin_2 (HMM E-Value=4.5) 27 9.5 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 103 bits (247), Expect = 7e-23 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +3 Query: 255 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPWR 395 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM APTK WR Sbjct: 60 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWR 106 Score = 74.5 bits (175), Expect = 4e-14 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = +1 Query: 76 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQT 255 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGHQT Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQT 59 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 35.1 bits (77), Expect = 0.027 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -3 Query: 408 TVPAPARASWGRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 271 T+P+P+ + R + HH + H + +HHH H H + Sbjct: 198 TMPSPSIVIYRRHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 34.7 bits (76), Expect = 0.036 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +3 Query: 237 GGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPW 392 GGW WG G+ + R GGG R G +G M GG P W Sbjct: 258 GGWGQGPGGGWGRGQG-RGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 308 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 Query: 375 RTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 R Y HH C H Y Y+ H H + + H YP RH Sbjct: 15 RCYRHHHYCCYCH--HRYCYYRHHHYCWYRHHYHYPCYRH 52 >SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 322 WVPPPRTRGIRATARPVPHD 263 W+PP RTR R T PV H+ Sbjct: 228 WMPPVRTRPARPTVMPVTHE 247 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.9 bits (64), Expect = 1.0 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 249 PNSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 368 P +E +G ++ R PR RGGG G G G RGGR Sbjct: 982 PTPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 237 GGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 GGW S WG G R +GGG R G +G GG Sbjct: 6 GGWGRGSGGGWGQGPG-GGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 28.3 bits (60), Expect = 3.1 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 237 GGWSPNSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPW 392 GG WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 271 HH RH R + +HHH H E+ ++H RY Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH-RY 353 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 348 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 YR H + +HHH H Q+H RH Sbjct: 307 YRYHHHHHHRHHHHHHHHHHQRHRHRHRHRH 337 >SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6) Length = 235 Score = 29.1 bits (62), Expect = 1.8 Identities = 26/82 (31%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = +3 Query: 201 VQELEAALLREQGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAP 380 V EL A + R+Q G S E+ R IP+ R GT R+ Q +C Sbjct: 141 VSELLAQVSRDQAGTGTYSVEALENKRVAVDIPK-RLTGTARAQQEVAPALC-------- 191 Query: 381 TKPWRALAPSRQ-XPTSXNGPW 443 W PS PTS +G W Sbjct: 192 -TVWACAQPSHAVRPTSSHGAW 212 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 372 TYVHHDTCYRRHPDRTYGYHHHGHA 298 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -3 Query: 348 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 Y +HP T+ YHH H + ++ ++P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 348 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 Y +HP T+ YH H + H ++P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 >SB_34202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +3 Query: 174 PGQ*CSRFYVQELEAALLREQG-GWSPNSAESWGTGRAVARIPRVRGGGT 320 P Q C + E+ +L G G P AE G ARI +RG GT Sbjct: 596 PAQPCKHLHSYTFESNILGNTGTGGYPGFAERGGRASYQARIQDLRGKGT 645 >SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -3 Query: 426 MSEXDATVPAPARASWGRTYVH-HDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 271 M++ T P + R Y H CYRR R + YHHH + +RY Sbjct: 199 MTKNPITSPDKVSSLPLRCYYHCRRRCYRRR--RRHFYHHHPRRYHNHRRLRY 249 >SB_34804| Best HMM Match : rve (HMM E-Value=1.2e-24) Length = 1725 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 142 PFVFKAPIRPDLVNDVHVSMSKNSRQ--PYCVSKEAGHQTVPNHGVPDVLLP 291 PF F P+R +L+N++H+ ++ ++ + P+ G Q V N GV +P Sbjct: 1264 PFYF--PLRLELINEIHLYITDDTGRTIPFLSGGFEGSQQVANPGVGLFTMP 1313 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 143 GRGLAAPCTVSLFSEYTDTKGRATDRLI 60 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) Length = 278 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 354 TCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTSLL 235 TC+ HP + Y H+ H F Q H + RH L TS L Sbjct: 52 TCFPYHPHYHHHYRHNDH-YFHQDH----LYRHYLSTSAL 86 >SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 27.9 bits (59), Expect = 4.1 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Frame = -3 Query: 405 VPAPARASWGRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTS-LLAH 229 V A + R +H+ T R+ + Y HH HA + R+ M + L T L H Sbjct: 1002 VHASYNSHTARHTMHYYTLTTRYTIQ-YDTVHHVHASYNSHTARHTMHYYTLTTRYTLKH 1060 Query: 228 AVGLPRVLGHRN 193 A P +L N Sbjct: 1061 AYETPLILNDIN 1072 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 Query: 367 RPPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHD 263 RPP H + P PD WVP P R +P D Sbjct: 250 RPPPHHDMRGP-PDQWVPGPEQRRDNMRGPGMPPD 283 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHH 307 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTSLL 235 HH + RH R + YHHH + H +P VT+++ Sbjct: 570 HHHLHHHRHHHRHHHYHHHHY----PHHHHHPCTIIIFVTTII 608 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 400 SARQGFVGAXIRPPRHMLPKAP*PDLWVPPP 308 +A F G +RPPRH+ ++P P PPP Sbjct: 316 TALAAFAGPTLRPPRHLPWQSPPPP---PPP 343 >SB_14341| Best HMM Match : DUF1339 (HMM E-Value=4.4) Length = 801 Score = 27.5 bits (58), Expect = 5.4 Identities = 21/56 (37%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +3 Query: 267 WGTGRAVARIPRVRGGGTHRS-GQGAFG-NMCRGGRMXAPTKPWRALAPSRQXPTS 428 W T R VA RVR G R QGA G + GR +P A AP + T+ Sbjct: 270 WATARVVAGRKRVRATGPRRGWSQGARGLGLLGHGRADIEPRPC-ACAPRHRAATT 324 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 369 YVHHDTCYRRHPDRTYGYHHHGH 301 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 372 TYVHHDTCYRRHPDRTYGYHHHGHA 298 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGH 301 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) Length = 434 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 228 REQGGWSPNSAESWGTGRAVARIPRVRGGG 317 R + W P + +W +A+ P VR GG Sbjct: 120 RPEAAWGPKRSGAWLGSQALVPQPAVRSGG 149 >SB_10758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 26.6 bits (56), Expect = 9.5 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +1 Query: 52 SSEMSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPY-- 225 S +M L R + Y+E ++ + LP V AP+ D+V +V S K S + Y Sbjct: 475 SPQMPLDFPRSFLEDYAEACANLK---QSLPQVHLAPLASDIVREVESSEVKLSLKFYVS 531 Query: 226 --CVSKEAGHQTV 258 C S EA +T+ Sbjct: 532 ENCPSVEAVVKTL 544 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 273 TGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 368 +G ++ R PR RGGG G G G RGGR Sbjct: 501 SGSSIVRRPRRRRGGGGGGGGGGGGGGGGRGGR 533 >SB_44405| Best HMM Match : Extensin_2 (HMM E-Value=4.5) Length = 325 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -3 Query: 369 YVHHDTCYRRH-PDRTYGYHHHGHAEFGQQH 280 Y HH Y H P Y +HHH H + QQH Sbjct: 297 YHHHHPPYHYHYPPLPYRHHHH-HNRY-QQH 325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,077,899 Number of Sequences: 59808 Number of extensions: 317084 Number of successful extensions: 956 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -