BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0127 (449 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Dros... 100 2e-21 X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Dros... 100 2e-21 BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p pro... 100 2e-21 AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p pro... 100 2e-21 AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA... 100 2e-21 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 31 0.71 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 31 0.71 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 31 0.71 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 31 0.71 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 31 0.71 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 31 0.94 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 31 0.94 AY113210-1|AAM29215.1| 872|Drosophila melanogaster AT06220p pro... 30 1.2 AE014296-2188|AAF49882.2| 271|Drosophila melanogaster CG17666-P... 30 1.2 AE014296-2187|AAN11857.1| 872|Drosophila melanogaster CG17666-P... 30 1.2 BT021357-1|AAX33505.1| 1953|Drosophila melanogaster LP14866p pro... 30 1.7 AE014298-1786|AAF48179.2| 2528|Drosophila melanogaster CG32654-P... 30 1.7 AE014296-3604|AAF51767.2| 706|Drosophila melanogaster CG32447-P... 30 1.7 DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup prote... 29 2.2 DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup prote... 29 2.2 AY122259-1|AAM52771.1| 2176|Drosophila melanogaster SD09011p pro... 29 2.2 AL009192-2|CAA15686.1| 2342|Drosophila melanogaster EG:133E12.4 ... 29 2.2 AF242291-1|AAF63753.1| 2362|Drosophila melanogaster nuclear prot... 29 2.2 AE014298-308|AAF45704.2| 2301|Drosophila melanogaster CG4399-PB ... 29 2.2 BT015281-1|AAT94510.1| 1489|Drosophila melanogaster LD08594p pro... 29 2.9 BT011124-1|AAR82791.1| 1489|Drosophila melanogaster LD09942p pro... 29 2.9 AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p pro... 29 2.9 AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative mic... 29 2.9 AE014297-286|AAF52001.1| 2296|Drosophila melanogaster CG2926-PA ... 29 2.9 AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA... 29 2.9 BT023938-1|ABB36442.1| 1103|Drosophila melanogaster RE04201p pro... 29 3.8 AY094813-1|AAM11166.1| 1413|Drosophila melanogaster LD30602p pro... 29 3.8 AY069251-1|AAL39396.1| 359|Drosophila melanogaster GM02568p pro... 29 3.8 AE014134-2739|AAF53547.2| 1413|Drosophila melanogaster CG31738-P... 29 3.8 AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-P... 29 3.8 AE013599-1786|AAZ52807.1| 359|Drosophila melanogaster CG13344-P... 29 3.8 AE013599-1785|AAF58321.2| 374|Drosophila melanogaster CG13344-P... 29 3.8 BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p pro... 28 5.0 AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p pro... 28 5.0 AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA... 28 5.0 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 28 6.7 AE014134-2664|AAN10926.1| 62|Drosophila melanogaster CG31820-P... 28 6.7 AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA... 28 6.7 J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.me... 27 8.8 DQ138914-1|ABA86520.1| 1422|Drosophila melanogaster CG8595 protein. 27 8.8 BT025836-1|ABF85736.1| 335|Drosophila melanogaster IP10849p pro... 27 8.8 BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p pro... 27 8.8 BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p pro... 27 8.8 BT001440-1|AAN71195.1| 219|Drosophila melanogaster GH25289p pro... 27 8.8 AF247765-1|AAF86225.1| 1446|Drosophila melanogaster Toll-7 protein. 27 8.8 AE014298-1116|AAF46317.2| 328|Drosophila melanogaster CG2256-PB... 27 8.8 AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-P... 27 8.8 AE014297-2664|AAF55671.2| 219|Drosophila melanogaster CG31221-P... 27 8.8 AE014297-2663|AAF55669.2| 219|Drosophila melanogaster CG31221-P... 27 8.8 AE013599-2957|AAF57514.1| 1446|Drosophila melanogaster CG8595-PA... 27 8.8 >X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Drosophila melanogastermRNA for put. ribosomal protein L1. ). Length = 407 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 255 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPWR 395 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM APTK +R Sbjct: 66 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFR 112 Score = 82.2 bits (194), Expect = 3e-16 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +1 Query: 61 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 240 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 241 AGHQT 255 AGHQT Sbjct: 61 AGHQT 65 >X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Drosophila gene forribosomal protein L1 fragment. ). Length = 123 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 255 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPWR 395 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM APTK +R Sbjct: 4 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFR 50 >BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p protein. Length = 233 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 255 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPWR 395 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM APTK +R Sbjct: 66 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFR 112 Score = 82.2 bits (194), Expect = 3e-16 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +1 Query: 61 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 240 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 241 AGHQT 255 AGHQT Sbjct: 61 AGHQT 65 >AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p protein. Length = 401 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 255 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPWR 395 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM APTK +R Sbjct: 66 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFR 112 Score = 82.2 bits (194), Expect = 3e-16 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +1 Query: 61 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 240 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 241 AGHQT 255 AGHQT Sbjct: 61 AGHQT 65 >AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA protein. Length = 401 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 255 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPTKPWR 395 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM APTK +R Sbjct: 66 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFR 112 Score = 82.2 bits (194), Expect = 3e-16 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +1 Query: 61 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 240 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 241 AGHQT 255 AGHQT Sbjct: 61 AGHQT 65 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 333 DRTYGYHHHGH 301 DR +G+HHHGH Sbjct: 71 DRDHGHHHHGH 81 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H DR +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DRDHGHHHHGH 81 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transmembrane protein Catecholaminesup protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-PA protein. Length = 449 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAE 295 G + HH + D +G+HHHGH E Sbjct: 90 GHDHGHHHHGHDHDHDHDHGHHHHGHDE 117 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p protein. Length = 175 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -2 Query: 364 PPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALFGDQPP 236 PP LP P P PPP T T P P + + PP Sbjct: 62 PPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPP 104 >AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA protein. Length = 172 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -2 Query: 364 PPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALFGDQPP 236 PP LP P P PPP T T P P + + PP Sbjct: 59 PPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPP 101 >AY113210-1|AAM29215.1| 872|Drosophila melanogaster AT06220p protein. Length = 872 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 278 TCCCP-NSACPWWWYP*VRSGC 340 TCC P ++ CPW WY +GC Sbjct: 718 TCCMPCSNQCPWSWYYNPCTGC 739 >AE014296-2188|AAF49882.2| 271|Drosophila melanogaster CG17666-PB, isoform B protein. Length = 271 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 278 TCCCP-NSACPWWWYP*VRSGC 340 TCC P ++ CPW WY +GC Sbjct: 117 TCCMPCSNQCPWSWYYNPCTGC 138 >AE014296-2187|AAN11857.1| 872|Drosophila melanogaster CG17666-PA, isoform A protein. Length = 872 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 278 TCCCP-NSACPWWWYP*VRSGC 340 TCC P ++ CPW WY +GC Sbjct: 718 TCCMPCSNQCPWSWYYNPCTGC 739 >BT021357-1|AAX33505.1| 1953|Drosophila melanogaster LP14866p protein. Length = 1953 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 66 SIGSPTFSVGVFREE*DGAGCSQAPPVRIQG--AHTSGPG 179 ++GSP ++VG G G S APP + AH +G G Sbjct: 287 AVGSPIYAVGASSAHSAGVGASPAPPTGVVAPPAHLAGIG 326 >AE014298-1786|AAF48179.2| 2528|Drosophila melanogaster CG32654-PC protein. Length = 2528 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 66 SIGSPTFSVGVFREE*DGAGCSQAPPVRIQG--AHTSGPG 179 ++GSP ++VG G G S APP + AH +G G Sbjct: 287 AVGSPIYAVGASSAHSAGVGASPAPPTGVVAPPAHLAGIG 326 >AE014296-3604|AAF51767.2| 706|Drosophila melanogaster CG32447-PA, isoform A protein. Length = 706 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = +3 Query: 168 SGPGQ*CSRFYVQELEAALLREQGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFG 347 +G G S F+ + ++ ++ G PNSA + G G + GG GQG Sbjct: 488 AGSGYSPSFFHFKPIKYGVM--SGCGLPNSASNTGQGLSSKHCSSANNGGEPDYGQGKSN 545 Query: 348 NMCRGGR 368 N+ R GR Sbjct: 546 NLWRCGR 552 >DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAE 295 HH + D +G+HHHGH E Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE 98 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAE 295 HH + D +G+HHHGH E Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE 98 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 396 PARASWGRTYVHHDTCYRRHPDRTYGYHHHGH 301 P +A + HHD H D +G+HHHGH Sbjct: 56 PQKAPRAEHHHHHD-----H-DHDHGHHHHGH 81 >AY122259-1|AAM52771.1| 2176|Drosophila melanogaster SD09011p protein. Length = 2176 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 234 QGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 +GG S ES GT + V ++ R GG SG G + GG Sbjct: 918 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 961 >AL009192-2|CAA15686.1| 2342|Drosophila melanogaster EG:133E12.4 protein. Length = 2342 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 234 QGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 +GG S ES GT + V ++ R GG SG G + GG Sbjct: 1042 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 1085 >AF242291-1|AAF63753.1| 2362|Drosophila melanogaster nuclear protein EAST protein. Length = 2362 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 234 QGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 +GG S ES GT + V ++ R GG SG G + GG Sbjct: 1095 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 1138 >AE014298-308|AAF45704.2| 2301|Drosophila melanogaster CG4399-PB protein. Length = 2301 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 234 QGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 +GG S ES GT + V ++ R GG SG G + GG Sbjct: 1042 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 1085 >BT015281-1|AAT94510.1| 1489|Drosophila melanogaster LD08594p protein. Length = 1489 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +3 Query: 204 QELEAALLREQGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 + L A L +QGG PN G G + + R G ++R G G GG Sbjct: 611 KHLTQAPLYQQGGGGPNYNRGGGAGSSDSYNNRYSGNTSYRGGGGGGAGGSSGG 664 >BT011124-1|AAR82791.1| 1489|Drosophila melanogaster LD09942p protein. Length = 1489 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +3 Query: 204 QELEAALLREQGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 + L A L +QGG PN G G + + R G ++R G G GG Sbjct: 611 KHLTQAPLYQQGGGGPNYNRGGGAGSSDSYNNRYSGNTSYRGGGGGGAGGSSGG 664 >AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p protein. Length = 572 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 337 P*PDLWVPPPRTRGIRATARPVPHDSAL 254 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative microtubule severingprotein katanin p60 subunit protein. Length = 571 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 337 P*PDLWVPPPRTRGIRATARPVPHDSAL 254 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >AE014297-286|AAF52001.1| 2296|Drosophila melanogaster CG2926-PA protein. Length = 2296 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +3 Query: 204 QELEAALLREQGGWSPNSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 365 + L A L +QGG PN G G + + R G ++R G G GG Sbjct: 611 KHLTQAPLYQQGGGGPNYNRGGGAGSSDSYNNRYSGNTSYRGGGGGGAGGSSGG 664 >AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA protein. Length = 572 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 337 P*PDLWVPPPRTRGIRATARPVPHDSAL 254 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >BT023938-1|ABB36442.1| 1103|Drosophila melanogaster RE04201p protein. Length = 1103 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/58 (27%), Positives = 22/58 (37%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTSLLAHAVGLPRVL 205 G T HH + H + HH H G ++S LA A GL R++ Sbjct: 1004 GATDSHHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1061 >AY094813-1|AAM11166.1| 1413|Drosophila melanogaster LD30602p protein. Length = 1413 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/58 (27%), Positives = 22/58 (37%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTSLLAHAVGLPRVL 205 G T HH + H + HH H G ++S LA A GL R++ Sbjct: 1314 GATDSHHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1371 >AY069251-1|AAL39396.1| 359|Drosophila melanogaster GM02568p protein. Length = 359 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = -3 Query: 426 MSEXDATVPAPARASWGRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQH 280 + E +P P ++ H+ R H +G+HH E G+Q+ Sbjct: 277 VQETHRIMPEPTNNNYHHNRRHYRGGRRHHHHHQHGHHHRAERERGEQN 325 >AE014134-2739|AAF53547.2| 1413|Drosophila melanogaster CG31738-PA, isoform A protein. Length = 1413 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/58 (27%), Positives = 22/58 (37%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTSLLAHAVGLPRVL 205 G T HH + H + HH H G ++S LA A GL R++ Sbjct: 1314 GATDSHHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1371 >AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-PB, isoform B protein. Length = 1700 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/58 (27%), Positives = 22/58 (37%) Frame = -3 Query: 378 GRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHCLVTSLLAHAVGLPRVL 205 G T HH + H + HH H G ++S LA A GL R++ Sbjct: 1601 GATDSHHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1658 >AE013599-1786|AAZ52807.1| 359|Drosophila melanogaster CG13344-PB, isoform B protein. Length = 359 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = -3 Query: 426 MSEXDATVPAPARASWGRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQH 280 + E +P P ++ H+ R H +G+HH E G+Q+ Sbjct: 277 VQETHRIMPEPTNNNYHHNRRHYRGGRRHHHHHQHGHHHRAERERGEQN 325 >AE013599-1785|AAF58321.2| 374|Drosophila melanogaster CG13344-PA, isoform A protein. Length = 374 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = -3 Query: 426 MSEXDATVPAPARASWGRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQH 280 + E +P P ++ H+ R H +G+HH E G+Q+ Sbjct: 292 VQETHRIMPEPTNNNYHHNRRHYRGGRRHHHHHQHGHHHRAERERGEQN 340 >BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p protein. Length = 798 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYP 268 H D+ RH R + +HHH H Q +P Sbjct: 384 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 415 >AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p protein. Length = 552 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYP 268 H D+ RH R + +HHH H Q +P Sbjct: 138 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 169 >AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA protein. Length = 980 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 363 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYP 268 H D+ RH R + +HHH H Q +P Sbjct: 566 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 597 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -2 Query: 364 PPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALFGDQPP 236 PP + AP P ++VPPP + I P P ++ PP Sbjct: 255 PPTKKVVIAP-PPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPP 296 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 364 PPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALFGDQPP 236 PP + AP P ++VPPP + + P P ++ PP Sbjct: 142 PPTKKVVIAP-PPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPP 183 >AE014134-2664|AAN10926.1| 62|Drosophila melanogaster CG31820-PA protein. Length = 62 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +2 Query: 266 MGYRTCCC-PNSACPWWWYP*VRSGC 340 M Y CCC PN C W P R C Sbjct: 26 MNYNNCCCGPNPPCGPWTCPPNRCCC 51 >AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA protein. Length = 218 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -3 Query: 360 HDTCYRRHPDRTYGYHH--HGHAEFGQQHVRY 271 H T + H + +G+HH HGH + H Y Sbjct: 41 HLTSHDDHHEEHHGHHHDHHGHDDHHDSHAEY 72 >J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.melanogaster forkhead protein (fkh) gene, complete cds. ). Length = 510 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -3 Query: 369 YVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHC 253 + + + C + P +HHH H + Q+ + M C Sbjct: 385 HANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRC 423 >DQ138914-1|ABA86520.1| 1422|Drosophila melanogaster CG8595 protein. Length = 1422 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -3 Query: 414 DATVPAPARASWGRTYVHHDTCYRR--HPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 +A+VPA S T RR P G +HH HA++ Q H P H Sbjct: 1282 NASVPAEQNYSTATTATPSPRPQRRGEQPGSGSGGNHHLHAQYYQHHGMRPPSEH 1336 >BT025836-1|ABF85736.1| 335|Drosophila melanogaster IP10849p protein. Length = 335 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 270 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPT 383 G GR+ P GG T +G G G GG APT Sbjct: 5 GKGRSPTPTPNRDGGATAGAGSGGGGGGGGGGVAAAPT 42 >BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p protein. Length = 510 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -3 Query: 369 YVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHC 253 + + + C + P +HHH H + Q+ + M C Sbjct: 385 HANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRC 423 >BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p protein. Length = 426 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -3 Query: 369 YVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHC 253 + + + C + P +HHH H + Q+ + M C Sbjct: 385 HANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRC 423 >BT001440-1|AAN71195.1| 219|Drosophila melanogaster GH25289p protein. Length = 219 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -3 Query: 318 YHHHGHAEFGQQH--VRYPMIRHCLV---TSLLAHAVGLPRVLGH 199 +HHH H + +QH +P CL+ T+ A+ L R+ GH Sbjct: 8 HHHHHHHQQPRQHHLSMWPSFAVCLLLLQTTTTTMAIDLSRLYGH 52 >AF247765-1|AAF86225.1| 1446|Drosophila melanogaster Toll-7 protein. Length = 1446 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -3 Query: 414 DATVPAPARASWGRTYVHHDTCYRR--HPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 +A+VPA S T RR P G +HH HA++ Q H P H Sbjct: 1294 NASVPAEQNYSTATTATPSPRPQRRGEQPGSGSGGNHHLHAQYYQHHGMRPPSEH 1348 >AE014298-1116|AAF46317.2| 328|Drosophila melanogaster CG2256-PB protein. Length = 328 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 270 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMXAPT 383 G GR+ P GG T +G G G GG APT Sbjct: 11 GKGRSPTPTPNRDGGATAGAGSGGGGGGGGGGVAAAPT 48 >AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-PA protein. Length = 510 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -3 Query: 369 YVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHC 253 + + + C + P +HHH H + Q+ + M C Sbjct: 385 HANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRC 423 >AE014297-2664|AAF55671.2| 219|Drosophila melanogaster CG31221-PB, isoform B protein. Length = 219 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -3 Query: 318 YHHHGHAEFGQQH--VRYPMIRHCLV---TSLLAHAVGLPRVLGH 199 +HHH H + +QH +P CL+ T+ A+ L R+ GH Sbjct: 8 HHHHHHHQQPRQHHLSMWPSFAVCLLLLQTTTTTMAIDLSRLYGH 52 >AE014297-2663|AAF55669.2| 219|Drosophila melanogaster CG31221-PA, isoform A protein. Length = 219 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -3 Query: 318 YHHHGHAEFGQQH--VRYPMIRHCLV---TSLLAHAVGLPRVLGH 199 +HHH H + +QH +P CL+ T+ A+ L R+ GH Sbjct: 8 HHHHHHHQQPRQHHLSMWPSFAVCLLLLQTTTTTMAIDLSRLYGH 52 >AE013599-2957|AAF57514.1| 1446|Drosophila melanogaster CG8595-PA protein. Length = 1446 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -3 Query: 414 DATVPAPARASWGRTYVHHDTCYRR--HPDRTYGYHHHGHAEFGQQHVRYPMIRH 256 +A+VPA S T RR P G +HH HA++ Q H P H Sbjct: 1294 NASVPAEQNYSTATTATPSPRPQRRGEQPGSGSGGNHHLHAQYYQHHGMRPPSEH 1348 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,080,562 Number of Sequences: 53049 Number of extensions: 512800 Number of successful extensions: 2985 Number of sequences better than 10.0: 212 Number of HSP's better than 10.0 without gapping: 2208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2932 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1455824790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -