BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0127 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.0 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 3.6 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 3.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 4.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 4.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.2 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 8.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.2 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 2.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 318 YHHHGHAEFGQQHVRY 271 +HHH H QH+ Y Sbjct: 351 HHHHHHQTQSLQHLHY 366 Score = 20.6 bits (41), Expect = 8.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 324 YGYHHHGHAEFGQ 286 YG H GHA+ G+ Sbjct: 210 YGRHLPGHAQMGR 222 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +1 Query: 217 QPYCVSKEAGHQTVPNHGVPDV 282 QP V+++ P HG P V Sbjct: 259 QPVTVNRQLNSDVQPGHGSPPV 280 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 3.6 Identities = 6/16 (37%), Positives = 7/16 (43%) Frame = +2 Query: 269 GYRTCCCPNSACPWWW 316 G+ C N WWW Sbjct: 353 GFLQPVCQNEMNKWWW 368 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 330 GQGAFGNMCRG 362 G G FG++CRG Sbjct: 640 GGGEFGDVCRG 650 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 4.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 300 AEFGQQHVRYPMIRHCLVTSLLAHAVGLPRVL 205 ++FG+ +V+Y L T LA AV VL Sbjct: 284 SQFGENNVQYQGSEDILNTQSLAKAVSKNGVL 315 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 120 RHIGPLTPFPPRFIPPDMYR 139 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = +1 Query: 175 LVNDVHVSMSKNSRQPYCVSKEAGHQTVPNHGVP 276 ++ DV + Y ++ +G +P HG+P Sbjct: 416 MLTDVFHVQETDKYDAYYGNRFSGEYEIPAHGLP 449 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 368 RHIGPLTPFPPRFIPPDMYR 387 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 353 RHIGPLTPFPPRFIPPDMYR 372 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 358 RHMLPKAP*PDLWVPPPRTR 299 RH+ P P P ++PP R Sbjct: 369 RHIGPLTPFPPRFIPPDMYR 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,963 Number of Sequences: 438 Number of extensions: 2649 Number of successful extensions: 24 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -