BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0124 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099... 33 0.13 10_08_0419 - 17783202-17784938 31 0.92 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 30 1.6 07_03_0293 + 16321539-16321893,16322020-16322207,16322881-163229... 27 8.6 04_04_1536 - 34207425-34207490,34207801-34208268,34208345-342084... 27 8.6 >08_02_0021 + 11307795-11308093,11308454-11308556,11309623-11309931, 11310190-11310618 Length = 379 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 205 SEEDWHKTRNSF*SIGTRSPGRGELYNGYSGREHRTSHPLEAAADRR 345 S ++W R SF R GRG ++ Y GR+ R P A RR Sbjct: 120 SMQEWSSERCSFVQEALRGSGRGHIWAFYRGRQRRLGPPPPLPARRR 166 >10_08_0419 - 17783202-17784938 Length = 578 Score = 30.7 bits (66), Expect = 0.92 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +2 Query: 266 DAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEIIDQFHV 445 DA + I G+ N+EP + LID + G M++ A A G+ PN + Sbjct: 352 DANDWIDGMTERNVEPDVVIYNILIDVYRRLGKMEDAMAVKEAMAKKGISPNVTTYNCLI 411 Query: 446 TNFN 457 T F+ Sbjct: 412 TGFS 415 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 12/57 (21%) Frame = +2 Query: 173 HGPHQPRPSFGQRKTG------------TRRGILFRASERDHQDAANSIMGIVVENI 307 HGPH P P FG+ G R G L+ A R D A + + V NI Sbjct: 253 HGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDIRVAVVNI 309 >07_03_0293 + 16321539-16321893,16322020-16322207,16322881-16322904, 16323497-16323550,16323854-16323944,16324715-16324815, 16324949-16324999,16326626-16326754,16327772-16327834, 16327928-16328171,16329628-16329776,16329855-16329944, 16330343-16330477,16330579-16330635,16331079-16331135, 16332299-16332336,16332532-16332601,16332971-16333207 Length = 710 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 596 SMTLAQITPCL*LSKNLLMALFKLSTAPVFQ 504 S LA + L +S ++L+ALFK ST P F+ Sbjct: 219 STELAPVLGLLMVSVSVLVALFKRSTVPTFK 249 >04_04_1536 - 34207425-34207490,34207801-34208268,34208345-34208485, 34208582-34208820,34209950-34210436 Length = 466 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 403 RSRSSGQRHRVDPVSVLEDSVD 338 RSR++G+R+R D V L +SVD Sbjct: 125 RSRAAGERYRHDGVEELPESVD 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,171,200 Number of Sequences: 37544 Number of extensions: 240346 Number of successful extensions: 838 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -