BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0122 (398 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 28 0.46 SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual 26 2.5 SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ... 25 3.3 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 25 5.7 SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p... 24 10.0 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 24 10.0 SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizo... 24 10.0 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 28.3 bits (60), Expect = 0.46 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 116 ILQHRRPRLPLMQLEAPCSFNFCSLRA 36 I Q LP + L +PCSF CSLRA Sbjct: 48 IAQKSNISLPFLTL-SPCSFTICSLRA 73 >SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 2.5 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 118 WHW-GSVDSISGSRXRFXLSXNSGRKHSRCCTSILRKL 228 W W GSVD SG N R S TS+LR++ Sbjct: 39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQV 76 >SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.4 bits (53), Expect = 3.3 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 164 NRXREPLMESTDPQCHILQHRRPRLPLMQLEAPCSF 57 N + M+S Q ++L RP LPL P F Sbjct: 81 NENGDLTMDSLSHQIYLLHKNRPTLPLKPTNQPTRF 116 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 24.6 bits (51), Expect = 5.7 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 49 QKLKEHGASSCISGKRGRRCCNIWHWGS 132 Q E A +C G G C +W+W + Sbjct: 394 QSSAEAAALACSGGSDGVTCGYMWYWNN 421 >SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 23.8 bits (49), Expect = 10.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 122 CHILQHRRPRLPLMQLEAPCSFNFCSLRAI 33 CH L HR+ L M+ + C C L A+ Sbjct: 647 CHHLYHRQCLLQWMETRSICPVCRCHLPAV 676 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 23.8 bits (49), Expect = 10.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 9 NIVAFIPAYRSKRTKIK 59 N V+ IP YR+ +TK+K Sbjct: 406 NAVSTIPVYRTTKTKMK 422 >SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizosaccharomyces pombe|chr 1|||Manual Length = 739 Score = 23.8 bits (49), Expect = 10.0 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 152 EPLMESTDPQCHILQHRRPRLPLMQL-EAPCSF 57 +P +TD Q ++ +H PRLP + + P SF Sbjct: 506 DPDPSNTDTQWNVEEHINPRLPEGSINDYPSSF 538 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,132,632 Number of Sequences: 5004 Number of extensions: 15109 Number of successful extensions: 24 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -