BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0122 (398 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0338 + 7426999-7428322,7428390-7428646 27 4.1 05_03_0618 - 16262826-16263097,16263111-16263183 27 4.1 04_03_0985 - 21438036-21438116,21438373-21438495,21438903-214389... 27 4.1 09_04_0269 + 16265191-16265472,16265574-16266149 27 5.5 03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461 27 7.2 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -1 Query: 146 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYY 12 LM C L HR P L + L A L+AI KSYY Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYY 441 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 31 RIARREQKLKEHGASSCISGKRGRRC 108 R+ARR + LK + C G R RRC Sbjct: 11 RMARRRRWLKRRRSGHCRCGLRSRRC 36 >04_03_0985 - 21438036-21438116,21438373-21438495,21438903-21438995, 21439176-21439388,21439589-21439687,21440248-21440317, 21442549-21442619,21442817-21442954,21443034-21443132, 21444061-21444144,21444268-21444324,21444594-21444683, 21444886-21445026,21445778-21445882,21445962-21446114, 21446215-21446316,21446404-21446562,21447039-21447222, 21447336-21447418,21447523-21447588,21447736-21447793, 21447903-21448003,21448269-21448355,21449063-21449185, 21449285-21449364,21449857-21450066,21450159-21450270, 21450709-21450927,21451356-21451726,21451866-21451965, 21452544-21452752,21453232-21453337,21453435-21453767 Length = 1439 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 127 GSVDSISGSRXRFXLSXNSGRKHSRCCTSI-LRKLSG 234 GS DS+ G + R + N K C T I LRKLSG Sbjct: 668 GSKDSLVGYQVRLDSARNERTKLLFCTTGILLRKLSG 704 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 143 MESTDPQCHILQHRRPRLPL 84 M T P C +L++ RPRLPL Sbjct: 157 MARTGPLCLLLENPRPRLPL 176 >03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461 Length = 353 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 37 ARREQKLKEHG-ASSCISGKRGRRCCNIWHWGSVDSISG 150 A RE + ++G A + G R N W G DS+SG Sbjct: 44 ALRESSVSQNGMAPPEPTAHEGHRASNSWSSGDTDSVSG 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,902,403 Number of Sequences: 37544 Number of extensions: 110616 Number of successful extensions: 205 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 205 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -